jayanthg757/stack_overflow
0
1Queries,Tags,language,Cleaned_Queries
2"sql query remembering certain results, regardless of database itself i'm using next/postgres to build a project, and i ran into this problem. //api/fetchpostlist/route.ts import { sql, db } from ""@vercel/postgres""; import { nextrequest, nextresponse } from '... postgresqlnext.jsnext.js13 user23704397 21 asked mar 21, 2024 at 9:47","['postgresql', 'next.js', 'next.js13']",en,sql query remembering certain results regardless database using nextposters build project ran problem apifetchpostlistroutets import sql db vesselposters import nextrequest nextresponse postgresqlnextnextjs user asked mar
3"how to scan built docker images using trivy in gitlab-ci pipeline? i am trying to write a gitlab-ci script to build images from dockerfiles, scan them using trivy and push them to my private registry. i've used the below script, and it works fine when i use it to ... dockerfilegitlab-cigitlab-ci-runnerbuildahtrivy lara 1 asked sep 28, 2023 at 19:51","['dockerfile', 'gitlab-ci', 'gitlab-ci-runner', 'buildah', 'trivy']",en,scan built decker images using privy githubci pipeline trying write githubci script build images dockerfiles scan using privy push private registry used script works fine use dockerfilegitlabcigitlabcirunnerbuildahtrivy lara asked sep
4"modulenotfounderror: no module named 'queue_pb2' i am currently trying to implement grpc with flask (grpc as a server and flask as the client side) but i keep facing this issue: modulenotfounderror: no module named 'queue_pb2' when i am trying to ... pythonflaskgrpcgrpc-python poetisme 29 asked oct 27, 2023 at 13:24","['python', 'flask', 'grpc', 'grpc-python']",en,modulenotfounderror module named queuepb currently trying implement grc flask grc server flask client side keep facing issue modulenotfounderror module named queuepb trying pythonflaskgrpcgrpcpython poetisme asked oct
5"is there a way to have the closing brace for a css class go to a new line when compiling sass with node sass? i am having some trouble with node-sass and my stylelint to write my css in the way i would like. right now, these are the rules i am using to line my css: { ""extends"": [ ""@... sassnode-sassstylelint zeropsi 694 asked oct 30, 2023 at 19:46","['sass', 'node-sass', 'stylelint']",en,way closing brace css class go new line compiling says node says trouble nodesays stylelint write css way would like right rules using line css extends sassnodesassstylelint zeros asked oct
6"loop through categories and posts of a custom post type in wordpress? i've created a custom post type called faq in wordpress and i've created a few categories for it - like ""billing"" and ""shipping"". my end goal is to create multiple faq ""posts&... phpwordpress sackadelic 1,033 asked feb 21, 2024 at 15:23","['php', 'wordpress']",en,loop categories posts custom post type wordpress created custom post type called faq wordpress created categories like billing shipping end goal create multiple faq posts phpwordpress sackadelic asked feb
7"how to change height of a card in flutter card( semanticcontainer: true, clipbehavior: clip.antialiaswithsavelayer, child: image.network( 'https://placeimg.com/640/480/any',fit: boxfit.fill), shape: roundedrectangleborder( ... flutterdartheightflutter-card justy 413 asked sep 26, 2019 at 10:48","['flutter', 'dart', 'height', 'flutter-card']",en,change height card clutter card semanticcontainer true clipbehavior clipantialiaswithsavelayer child imagenetwork boxsetfill shape roundedrectangleborder flutterdartheightfluttercard asked sep
8"nvm_nodejs_org_mirror is not working from local server i want to use this nvm_nodejs_org_mirror env variable on my computer to be able to download node tar.xz from my local server instead of the official dist. steps which i did -> export ... node.jslinuxnvm adrianeo 141 asked apr 28, 2023 at 6:42","['node.js', 'linux', 'nvm']",en,numnodesorgmirror working local server want use numnodesorgmirror env variable computer able download node tarxz local server instead official dist steps export nodejslinuxnvm adrian asked apr
9"dropdowns are not working using react-draft-wysiwyg in react js i tried to use react-draft-wysiwyg using the docs some icons are displayed but not working : block type, font, font size,pickercolor (the dropdowns are not working). for example, the font size is set ... javascriptreactjsreact-hooksreact-draft-wysiwyg zokulko 229 asked apr 29, 2022 at 13:16","['javascript', 'reactjs', 'react-hooks', 'react-draft-wysiwyg']",en,dropdown working using reactdraftwysiwyg react js tried use reactdraftwysiwyg using docs icons displayed working block type font font sizepickercolor dropdown working example font size set javascriptreactjsreacthooksreactdraftwysiwyg zokulko asked apr
10"how to convert all decimal numbers in a string to binary in java? i needed to convert decimal numbers in a string to binary. i needed to use it for a program. i tried this code: static string numbers = ""48, 40, 6, 82, 222, 94, 152, 46, 77""; public ... javastringbinary yahyab 84 asked 21 hours ago","['java', 'string', 'binary']",en,convert decimal numbers string binary java needed convert decimal numbers string binary needed use program tried code static string numbers public javastringbinary yahyab asked hours ago
11"creating a private dns zone a record in terraform so i have a terraform script where i am creating a private dns zone (azurerm_private_dns_zone.flexpsql) with a network link. i need to create an a record in a separate private dns zone (data.... terraformterraform-provider-azureazure-rm nerd in training 2,240 asked aug 28, 2023 at 20:17","['terraform', 'terraform-provider-azure', 'azure-rm']",en,creating private dns zone record terraform terraform script creating private dns zone azureprivatednszoneflexpsql network link need create record separate private dns zone data terraformterraformproviderazureazurerm nerd training asked aug
12"asp.net identity: createasync cannot access a disposed object i am trying to create a user from a blazer component. here is my injection: @inject usermanager<customuser> usrm and the implementation: async task<bool> createloginuser() { ... c#asp.net-coreblazorasp.net-identityblazor-server-side wades 302 asked nov 23, 2023 at 1:51","['c#', 'asp.net-core', 'blazor', 'asp.net-identity', 'blazor-server-side']",en,aspnet identity createasync cannot access disposed object trying create user blaze component injection inject usermanager usr implementation sync task createloginuser caspnetcoreblazoraspnetidentityblazorserverside waves asked nov
13"fallback to a default value on kotlin deserialization error i am using kotlin serialization to deserialize a json response from the network. when there are errors during the deserialization, i would like to catch them and fallback to a default value (ideally ... jsonkotlinserialization david ferrand 5,490 asked dec 4, 2023 at 19:15","['json', 'kotlin', 'serialization']",en,fullback default value koeln serialization error using koeln serialization deserialize son response network errors serialization would like catch fullback default value ideally jsonkotlinserialization david fernando asked dec
14"swiftui development for macos 10.15 with xcode 14: errors and setup i'm using macos veneer and xcode 14 to develop a macos application with a target development set to macos 10.15. as i'm new to coding with swiftui, i encountered a few errors when i changed the target ... swiftxcodeswiftui pastor j.g seigle 165 asked jun 15, 2023 at 4:40","['swift', 'xcode', 'swiftui']",en,swift development marcos code errors setup using marcos veneer code develop marcos application target development set marcos new coding swift encountered errors changed target swiftxcodeswiftui pastor jg single asked jun
15"how to make an instance method accept only the name of another instance method? i have an object with some properties and methods. how do i give it a method that accepts only the name of another one of its methods? for example, consider the command method in this user class. we ... javascripttypescript robertakarobin 4,284 asked nov 16, 2023 at 21:42","['javascript', 'typescript']",en,make instance method accept name another instance method object properties methods give method accepts name another one methods example consider command method user class javascripttypescript robertakarobin asked nov
16"nextjs, improve db query performance by caching the data so, i have this pricing page that displays the prices of my saas products to users. however, the problem is that i fetch the data for these products from a supabase database, which is really slow. i'm ... next.js john 727 asked oct 28, 2023 at 15:37",['next.js'],en,next improve db query performance caching data pricing page displays prices says products users however problem fetch data products supabase database really slow nextjs john asked oct
17"torchvision v2 transform - can't get transform to work (or just plot...?) i am working on training a deeplabv3+ model to segment ct images, as a test i want to visualise the transformations applied. however i cannot get the transforms to plot/save. the slice has been ... pythontransformtorchvision sumerechny 168 asked oct 20, 2023 at 15:33","['python', 'transform', 'torchvision']",en,torchvision v transform cannot get transform work plot working training deeplabv model segment ct images test want visualize transformations applied however cannot get transforms plotsave slice pythontransformtorchvision sumerechny asked oct
18"tests/scenarios not getting executed using testng cucumber getting the below output after executing a test from testng runner class(testng-cucumber) but no tests are getting executed- [remotetestng] detected testng version 7.4.0 passed: runscenario(""... cucumbercucumber-java shreyas lembhe 37 asked jan 1, 2024 at 8:02","['cucumber', 'cucumber-java']",en,testsscenarios getting executed using testing cucumber getting output executing test testing runner classtestingcucumber tests getting executed remotetestng detected testing version passed runscenario cucumbercucumberjava shreyas cembre asked jan
19"how do i add a fixed widget to an eclipse rcp top trimbar? we want to display an image to the left of the toolbars of our eclipse rcp application, like this: our app has a setting that allows the user to change the size of the toolbars: we tried the ... eclipse-rcpe4 mario marinato 4,627 asked jan 11, 2024 at 12:28","['eclipse-rcp', 'e4']",en,add fixed widget eclipse cp top timber want display image left toolbar eclipse cp application like app setting allows user change size toolbar tried eclipserape mario marina asked jan
20"how to stop kernel messages being printed to console with getty service killed i have an embedded linux system, with /proc/cmdline containing console=<uart device> and earlycon=<uart device>. shortly after each boot, a getty service will turn <uart device> into ... linuxlinux-kernelkernelembedded-linux ken lin 1,065 asked aug 24, 2023 at 18:47","['linux', 'linux-kernel', 'kernel', 'embedded-linux']",en,stop kernel messages printed console petty service killed embedded linux system procmidline containing console earlycon shortly boot petty service turn linuxlinuxkernelkernelembeddedlinux ken lin asked aug
21"resolving hydration error in next.js app with material-ui theme change i am working on nextjs project for the project i was required to create a theme switcher i am using muiv5 as styling foundation and i have managed to create a theme switcher which switch between ... reactjsnext.jsmaterial-uiserver-side-renderinghydration zaid shaikh 33 asked feb 10, 2023 at 12:43","['reactjs', 'next.js', 'material-ui', 'server-side-rendering', 'hydration']",en,resolving hydration error nextjs app materialui theme change working next project project required create theme switched using mui styling foundation managed create theme switched switch reactjsnextmaterialserversiderenderinghydration said sheikh asked feb
22"how to solve the unsupported class file major version 63 error when using eclipse to build the ghidra plug-in? how to solve the unsupported class file major version 63 error when using eclipse to build the ghidra plug-in? version： eclipse：4.19.0; gradle：6.8.1; java sdk：16.0.1; ghidra：9.2.2; report error： ... eclipsegradleghidra stay 21 asked dec 13, 2022 at 3:57","['eclipse', 'gradle', 'ghidra']",en,solve unsupported class file major version error using eclipse build chira plugin solve unsupported class file major version error using eclipse build chira plugin version eclipse grade java sdk chira report error eclipsegradleghidra stay asked dec
23"how do i tell cmake to use ninja instead of make? [duplicate] in vscode i found a n extension ""cpp cmake ninja project generator"" and it generated the cmakelists.txt: cmake_minimum_required(version 3.20) project(n version 1.0.0 languages cxx) set(... c++cmakeninja user11566470 83 asked apr 20 at 23:08","['c++', 'cmake', 'ninja']",en,tell make use ninja instead make duplicate uscode found n extension cpp make ninja project generator generated cmakeliststxt makeminimumrequiredversion projectn version languages xx set ccmakeninja user asked apr
24"orleans slow with minimalistic use case i'm evaluating orleans for a new project we are starting soon. eventually we want to run a bunch of persistent actors, but i'm currently struggling to just get base line in memory version of orleans ... c#.netazure-table-storageactororleans murdock 4,682 asked nov 3, 2022 at 23:33","['c#', '.net', 'azure-table-storage', 'actor', 'orleans']",en,orleans slow minimalist use case evaluating orleans new project starting soon eventually want run bunch persistent actors currently struggling get base line memory version orleans cnetazuretablestorageactororleans murdock asked nov
25"parallel processing in php - how do you do it? i am currently trying to implement a job queue in php. the queue will then be processed as a batch job and should be able to process some jobs in parallel. i already did some research and found ... phpmultithreadingparallel-processingtask-queue enricog 4,273 asked may 24, 2011 at 7:56","['php', 'multithreading', 'parallel-processing', 'task-queue']",en,parallel processing php currently trying implement job queue php queue processed batch job able process jobs parallel already research found phpmultithreadingparallelprocessingtaskqueue enrich asked may
26"c# eventhandler invoke in class a, action to run in class b i have implemented an eventhandler that should be invoked when ""openproject"" is completed. the event is listened from another class. what i see testing the code is that the ""work inside&... c#eventhandler user8608762 asked feb 18, 2024 at 15:04","['c#', 'eventhandler']",en,c eventhandler invoke class action run class b implemented eventhandler invoked openproject completed event listened another class see testing code work inside ceventhandler user asked feb
27"for some reason typoscript is not creating symlink to my public folder after i added my typoscript page logic like the following: config { contentobjectexceptionhandler = 0 } page = page -- some code --- page.includejsfooter { jquery = https://code.jquery.com/... typo3symlinktyposcript naseem toumeh 13 asked nov 23, 2023 at 10:28","['typo3', 'symlink', 'typoscript']",en,reason typoscript creating symlink public folder added typoscript page logic like following config contentobjectexceptionhandler page page code pageincludejsfooter query typosymlinktyposcript seem touch asked nov
28"initializing properties in the primary constructor of a kotlin data class i'm working on a kotlin project that needs to work with 'rational' numbers. to do that i have a class that stores a rational number as two integers (numerator and denominator) and performs some ... kotlinclassconstructorinitialization pbuchheit 1,701 asked nov 16, 2023 at 19:32","['kotlin', 'class', 'constructor', 'initialization']",en,initializing properties primary constructor koeln data class working koeln project needs work rational numbers class stores rational number two integers numerator denominator performs kotlinclassconstructorinitialization pbuchheit asked nov
29"getting error, timeout value connect is not int when using selenium4 python3 edge 117 webdriver i am writing a script in python3.11 to automate edge (version=117) in selenium4. upon executing the statement driver = webdriver.edge(r'c:\edge_web\msedgedriver.exe') a command window pops up and i ... pythonselenium-webdriverwebdrivermicrosoft-edge steve95959 1 asked sep 27, 2023 at 6:19","['python', 'selenium-webdriver', 'webdriver', 'microsoft-edge']",en,getting error timeout value connect int using selenium python edge webdriver writing script python automate edge version selenium upon executing statement driver webdriveredgercedgewebmsedgedriverexe command window pops pythonseleniumwebdriverwebdrivermicrosoftedge steve asked sep
30"'testcase' object is not subscriptable ->robotframework listener i am trying to use a listener to save data from mi test case (develop in robotframework)so i develop this listener: from robot.libraries.builtin import builtin import psycopg2 import datetime class ... robotframeworklistener maría luján tissera 1 asked oct 20, 2023 at 13:36","['robotframework', 'listener']",en,testcases object subscriptable robotframework listener trying use listener save data mi test case develop robotframeworkso develop listener robotlibrariesbuilt import built import psycopg import daytime class robotframeworklistener maria luan tissera asked oct
31apple developer program can't verify my identity [closed] i tried to enroll in the apple developer program with my primary icloud email. during the enrollment process it requested that i upload pictures of the front and back of my driver's license. after i ... iosapple-developerapple-developer-account jarrodwhitley 826 asked 17 hours ago,"['ios', 'apple-developer', 'apple-developer-account']",en,apple developer program cannot verify identity closed tried enroll apple developer program primary cloud email enrollment process requested upload pictures front back drivers license iosappledeveloperappledeveloperaccount jarrodwhitley asked hours ago
32"how to animate a favicon? how to animate a favicon like that? it seems to work only in firefox. htmlfavicon tonyf 35.6k asked dec 3, 2009 at 2:23","['html', 'favicon']",en,animate flagicon animate flagicon like seems work firefox htmlfavicon tony k asked dec
33"how to await forkjoin.subscribe to use the values this is a continuation from this post but i am creating a new post as it is different the original question. question - how to await forkjoin to complete before i run other business logic. code below ... javascriptangulartypescriptrxjs vivek shukla 743 asked jun 6, 2023 at 12:39","['javascript', 'angular', 'typescript', 'rxjs']",en,await forkjoinsubscribe use values continuation post creating new post different original question question await forkjoin complete run business logic code javascriptangulartypescriptrxjs vive sulla asked jun
34"how to render different images based on screen size i want to render a different svg based on the browser screen width. i've found a solution that expects me to use srcset within an img tag. however, i can't get it to work. the goal should be to render ... javascriptreactjstailwind-css user18951127 asked apr 26, 2022 at 10:05","['javascript', 'reactjs', 'tailwind-css']",en,render different images based screen size want render different svg based browser screen width found solution expects use srcset within img tag however cannot get work goal render javascriptreactjstailwindcss user asked apr
35"android fade in and fade out with imageview i'm having some troubles with a slideshow i'm building. i've created 2 animations in xml for fade in and fade out: fadein.xml <?xml version=""1.0"" encoding=""utf-8""?> <set xmlns:... androidanimationimageviewfadeinfadeout ipvalverde 2,029 asked jan 4, 2012 at 0:29","['android', 'animation', 'imageview', 'fadein', 'fadeout']",en,android fade fade pageview troubles slideshow building created animations xml fade fade adminxml set xmlns androidanimationimageviewfadeinfadeout ipvalverde asked jan
36"those columns are out of bound error at autoresizecolumns method i have 2d array data to add to the sheet. i have a script that will add columns in the google app script. i used the setvalue method for adding data in the google sheet. i had data of length 784 to ... google-apps-scriptgoogle-sheetsgoogle-sheets-apiadd-on shiv yadav 311 asked jun 12, 2023 at 4:52","['google-apps-script', 'google-sheets', 'google-sheets-api', 'add-on']",en,columns bound error autoresizecolumns method array data add sheet script add columns google app script used statvalue method adding data google sheet data length googleappsscriptgooglesheetsgooglesheetsapiaddon ship yadav asked jun
37"match.params.id not working in react router dom i have installed the latest version of react-router-dom in my project. and it is saying match is undefined. however, it works fine when i use [email protected]. can anybody tell me how should i ... reactjsreact-nativematch rubayat26 195 asked jan 28, 2022 at 17:13","['reactjs', 'react-native', 'match']",en,matchparamsid working react router dom installed latest version reactrouterdom project saying match undefined however works fine use email protected anybody tell reactjsreactnativematch rubayat asked jan
38"sorting the value zero in jquery datatables yadcf doesn't work we have a big problem when using the jquery library datatables with jquery.datatables.yadcf : sorting doesn't work when we want to select the value 'zero', for example in a column witch concern delay ... yadcf juan de bourbon 3 asked sep 20, 2024 at 8:57",['yadcf'],en,sorting value zero query datatables acf work big problem using query library datatables querydatatablesacf sorting work want select value zero example column witch concern delay acf juan de bourbon asked sep
39"azure spring app deployment, controller 404 not found i am trying to deploy spring app on azure app service. i added to build.gradle instructions with plugin like below: azurewebapp { subscription = 'xxx' resourcegroup = 'xxx' appname = 'xxx' ... javaazuregradlehttp-status-code-404 coriver 13 asked sep 28, 2023 at 11:27","['java', 'azure', 'gradle', 'http-status-code-404']",en,azure spring app deployment controller found trying deploy spring app azure app service added buildgrade instructions plugin like azurewebapp subscription xxx resourcegroup xxx altname xxx javaazuregradlehttpstatuscode cover asked sep
40"how to generate a blob signed url in google cloud run? under google cloud run, you can select which service account your container is running. using the default compute service account fails to generate a signed url. the work around listed here works on ... pythongoogle-cloud-storagegoogle-cloud-rungoogle-iam sww314 1,342 asked oct 6, 2020 at 21:43","['python', 'google-cloud-storage', 'google-cloud-run', 'google-iam']",en,generate blob signed url google cloud run google cloud run select service account container running using default compute service account fails generate signed url work around listed works pythongooglecloudstoragegooglecloudrungoogleiam www asked oct
41"typeerror: cannot read properties of null (reading 'sw') using google-maps api and rapidapi i am facing this error while using google-maps api and and another api from rapidapi. first this is the code that works: api -> index.js import axios from ""axios""; const url = ""... javascriptgoogle-maps-api-2rapidapi priyam 230 asked sep 4, 2021 at 11:50","['javascript', 'google-maps-api-2', 'rapidapi']",en,typeerror cannot read properties null reading sw using googlemaps api rapidapi facing error using googlemaps api another api rapidapi first code works api indexjs import axis axis const url javascriptgooglemapsapirapidapi prism asked sep
42"execute external javascript embedded in inline html from .net maui windows desktop application i have an html code embedded in c# .net maui windows desktop application. the html references to external javascript files but this code doesn't work in .net maui solution for windows desktop app. any ... c#windowsmaui leo rodrigues 1 asked dec 12, 2023 at 11:04","['c#', 'windows', 'maui']",en,execute external javascript embedded inline html net mai windows desktop application html code embedded c net mai windows desktop application html references external javascript files code work net mai solution windows desktop app cwindowsmaui leo rodriguez asked dec
43"bootstrap icon content is not exactly in the middle this is my website's settings button. it may be visible, but it is slightly tilted to the upper right. it is not a failure of vertical center alignment. i want this bootstrap icon gear-fill to ... css yeol 1 asked mar 12, 2024 at 3:53",['css'],en,bootstrap icon content exactly middle websites settings button may visible slightly tilted upper right failure vertical center alignment want bootstrap icon gearfill css yeol asked mar
44"how to type function with variadic number of generic type variables in typescript? given type loadable<t> = () => t type loadablecombinerresult<t> = { result: t } i would like define types for a function with input like this: variable number of loadable<... typescriptgenericsvariadic-functions kravemir 11.1k asked dec 15, 2023 at 10:33","['typescript', 'generics', 'variadic-functions']",en,type function variadic number generic type variables typescript given type readable type loadablecombinerresult result would like define types function input like variable number readable typescriptgenericsvariadicfunctions kravemir k asked dec
45"check specific custom attribute from the variation of a woocommerce variable product in woocommerce, i have a variable product type product with id 1010. this product has an attribute name: ""book terms"" with two defined product types value(s): ""phys (best)"" ""... phpwordpresswoocommerceordersproduct-variations john 7 asked feb 3, 2024 at 12:55","['php', 'wordpress', 'woocommerce', 'orders', 'product-variations']",en,check specific custom attribute variation woocommerce variable product woocommerce variable product type product id product attribute name book terms two defined product types values phys best phpwordpresswoocommerceordersproductvariations john asked feb
46"failed to parse url from cadence-parser.wasm i am trying to utilize cadence parser package in one of my project and for some reason i am getting the error from title. i've used example provided in readme: import { cadenceparser } from ""@... node.jswebassemblynpm-packageonflow-cadence maxstarka 91 asked oct 25, 2023 at 17:04","['node.js', 'webassembly', 'npm-package', 'onflow-cadence']",en,failed parse url cadenceparserwas trying utilize cadence parser package one project reason getting error title used example provided read import cadenceparser nodejswebassemblynpmpackageonflowcadence maxstarka asked oct
47"why does the string class have the parameterless constructor and the constructor that takes a string literal as argument? the string constructor that takes a string literal argument has the following implementation. @intrinsiccandidate public string(string original) { this.value = original.value; ... javastringimplementationpoolstring-literals kuruthi 11 asked jan 22, 2024 at 5:15","['java', 'string', 'implementation', 'pool', 'string-literals']",en,string class parameterless constructor constructor takes string literal argument string constructor takes string literal argument following implementation intrinsiccandidate public stringstring original thisvalue originalvalue javastringimplementationpoolstringliteral kuruthi asked jan
48"separate wrap text to multiple rows in excel i've an issue which is i couldnt seperate wrap text cell to multiple row in excel, here is the example :- wrap text : without wrap text : so now i want to separate the without wrap text to multiple ... excelexcel-formulacell sephiroth 59 asked aug 16, 2023 at 11:34","['excel', 'excel-formula', 'cell']",en,separate wrap text multiple rows excel issue could seperate wrap text cell multiple row excel example wrap text without wrap text want separate without wrap text multiple excelexcelformulacell sephiroth asked aug
49"why is my button(id=""closedialogbtn"") not working? i want to use dialog element while update the the dom. when i try to update the dom and open the dialog with the button containing id=""opendialogbtn"". the dialog box is working fine(able to ... javascripthtmldialog eeshalteluri 1 asked mar 5, 2024 at 10:29","['javascript', 'html', 'dialog']",en,buttonidclosedialogbtn working want use dialog element update dom try update dom open dialog button containing idopendialogbtn dialog box working fineable javascripthtmldialog eeshalteluri asked mar
50"selective data export in json from sling model exporter in aem? i have successfully implemented a sling model exporter, but i'm facing an issue where the entire dataset, including unwanted information like null values, is being exported in json. how can i ensure ... javaaemsling-models snagendra prasad 3 asked mar 14, 2024 at 9:42","['java', 'aem', 'sling-models']",en,selective data export son sling model exporter successfully implemented sling model exporter facing issue entire dataset including unwanted information like null values exported son ensure javaaemslingmodels narendra prasad asked mar
51"how to create conda env with both name and path specified os: windows 10 it's fine to create an env with either name or path, but it doesn't work with both name and path: command: conda create -name myname --prefix d:\proj\myconda\myname error: conda ... anaconda jiongjiong li 541 asked apr 3, 2018 at 20:07",['anaconda'],en,create honda env name path specified os windows fine create env either name path work name path command honda create name mname prefix dprojmyconetmname error honda anaconda jiongjiong li asked apr
52"fastest way to generate shuffled range array form zero to x i'm trying to find the fastest way to generate a shuffled array of indices. a shuffled range from 0 to a number, so to say. currently i've compared these two methods: setup = ""import numpy as np; ... pythonnumpyrandomrange htf-struggle 15 asked dec 24, 2023 at 12:48","['python', 'numpy', 'random', 'range']",en,fastest way generate shuffled range array form zero x trying find fastest way generate shuffled array indices shuffled range number say currently compared two methods setup import num np pythonnumpyrandomrange utfstruggle asked dec
53"vscode adds extra indent to closing parenthesis in python i'm encountering an issue with vscode where, when splitting long function calls onto multiple lines, the closing parenthesis gets an extra indentation. in particular, when i hit enter after the last ... pythonvisual-studio-codevscode-extensions theportakal 239 asked feb 21, 2024 at 16:00","['python', 'visual-studio-code', 'vscode-extensions']",en,uscode adds extra indent closing parenthesis python encountering issue uscode splitting long function calls onto multiple lines closing parenthesis gets extra indentation particular hit enter last pythonvisualstudiocodevscodeextensions theportakal asked feb
54"how to setup alerting for the dataform gcp integration? for the dataform google cloud platform integration, how (if possible in the first place) to setup notifications / alerting in case any action - and which action - in the workflow as scheduled via ... google-cloud-platformgoogle-bigquerydataform timo rietveld 541 asked mar 10, 2023 at 16:33","['google-cloud-platform', 'google-bigquery', 'dataform']",en,setup alerting dataform gap integration dataform google cloud platform integration possible first place setup notifications alerting case action action workflow scheduled via googlecloudplatformgooglebigquerydataform timo rietveld asked mar
55"chrome webdriver version 106 goes into exception > uniquecontextid not found elementexist exception i have recently updated chrome and its web driver from version 103 to version 106. the piece of code, contained in the attached image, which previously worked now goes into ... exceptionselenium-chromedriverwebdriver frank 37 asked oct 6, 2022 at 20:20","['exception', 'selenium-chromedriver', 'webdriver']",en,chrome webdriver version goes exception uniquecontextid found elementexist exception recently updated chrome web driver version version piece code contained attached image previously worked goes exceptionseleniumchromedriverwebdriver frank asked oct
56"""wsl installation error: 'the system cannot find the path specified' on windows 11"" [closed] i am trying to install wsl (windows subsystem for linux) on my windows 10 system. i followed the steps to enable the required features using the following commands in an elevated command prompt (run ... installationwindows-subsystem-for-linuxcommand-promptvirtualizationwindows-11 rafi agasya 1 asked 23 hours ago","['installation', 'windows-subsystem-for-linux', 'command-prompt', 'virtualization', 'windows-11']",en,sl installation error system cannot find path specified windows closed trying install sl windows subsystem linux windows system followed steps enable required features using following commands elevated command prompt run installationwindowssubsystemforlinuxcommandpromptvirtualizationwindows afi alaska asked hours ago
57"did not find frame i get the following error when using inappwebview and switching between pages, works in one emulator, not in another e/frameevents( 5237): updateacquirefence: did not find frame. androidflutterdartvisual-studio-codeandroid-webview yusuf brly 97 asked sep 24, 2022 at 9:05","['android', 'flutter', 'dart', 'visual-studio-code', 'android-webview']",en,find frame get following error using inappwebview switching pages works one emulator another eframeevents updateacquirefence find frame androidflutterdartvisualstudiocodeandroidreview usf brgy asked sep
58"how can i save a text block in visual mode to a file in vim? the title is very descriptive. just in case, i will give an example: start block1 something end block1 start block2 something somenthing... end block2 i select the block1 in visual mode i yank it by ... filevimsaveselection léo léopold hertz 준영 142k asked apr 28, 2009 at 21:28","['file', 'vim', 'save', 'selection']",en,save text block visual mode file title descriptive case give example start block something end block start block something something end block select block visual mode rank filevimsaveselection leo leopold junyeong k asked apr
59"gitlab cloud run deploy successfully but job failed im having an issue with my ci/cd pipeline , its successfully deployed to gcp cloud run but on gitlab dashboard the status is failed. i tried to replace images to some other docker images but it fails ... google-cloud-platformgitlab mikcode 2,855 asked oct 1, 2021 at 17:51","['google-cloud-platform', 'gitlab']",en,github cloud run deploy successfully job failed issue cicd pipeline successfully deployed gap cloud run github dashboard status failed tried replace images decker images fails googlecloudplatformgitlab bibcode asked oct
60"how to specify managed resource path in solr how do i specify the default path to managed resources files in solr. i am using synonyms via managed resources api and it creates the synonyms config file under /var/solr/data/collection1/conf/... solrpathresourcessolr9solr-9.3.0 baama 2,642 asked sep 6, 2024 at 10:53","['solr', 'path', 'resources', 'solr9', 'solr-9.3.0']",en,specify managed resource path sold specify default path managed resources files sold using synonyms via managed resources api creates synonyms config file varsolddatacollectionconf solrpathresourcessolrsold drama asked sep
61"no devices found with name or id matching 'emulator-5554' even though the flutter doctor is ok when i run my program on the emulator the console shows this: no devices found with name or id matching 'emulator-5554' the flutter doctor is ok. how do i fix this? c:\users\athir>flutter doctor -... flutterandroid-studioandroid-emulator athiruj kaewseesuk 61 asked jun 11, 2021 at 11:39","['flutter', 'android-studio', 'android-emulator']",en,devices found name id matching emulator even though clutter doctor ok run program emulator console shows devices found name id matching emulator clutter doctor ok fix cusersthisclutter doctor flutterandroidstudioandroidemulator athiruj kaewseesuk asked jun
62"linux kernel virtual memory space, address handling and virtual memory confusion i am trying to implement the meltdown vulnerability on a linux intel x86 laptop for a class demo. in the machine i am using i have nokaslr and pti=off in the kernel parameters. i have created a kernel ... linuxoperating-systemvirtual-memory alfredo baciu 95 asked nov 5, 2023 at 21:10","['linux', 'operating-system', 'virtual-memory']",en,linux kernel virtual memory space address handling virtual memory confusion trying implement meltdown vulnerability linux intel x laptop class demo machine using nokaslr ptioff kernel parameters created kernel linuxoperatingsystemvirtualmemory alfred back asked nov
63"how do i prevent function-data overlap when multiple independent threads are trying to execute 1 function? i am trying to create a depth tree in c# (.net core 3.1) for a chess program. i use a branching technique that uses multiple functions, but 1 function is used very often. the process goes repeat to a ... c#multithreadingthread-safetytask.net-core-3.1 iwechampionsi 7 asked apr 4, 2024 at 16:36","['c#', 'multithreading', 'thread-safety', 'task', '.net-core-3.1']",en,prevent functiondata overlap multiple independent threads trying execute function trying create depth tree c net core chess program use branching technique uses multiple functions function used often process goes repeat cmultithreadingthreadsafetytasknetcore iwechampionsi asked apr
64"dynamic form handling i'm creating a dynamic form with core javascript. i am only able to create input fields but i'm not able to handle the values of inputs and also not to apply any functionality...
var formfield = ... javascripthtmlfunction naveen nizam 335 asked mar 20, 2024 at 5:41","['javascript', 'html', 'function']",en,dynamic form handling creating dynamic form core javascript able create input fields able handle values inputs also apply functionality var formfield javascripthtmlfunction nica asked mar
65"elasticsearch-dsl intervals query i am using this library to make elastic search queries. it says that it supports intervals query but i can not find a good example that could help me in making my query. my query is as follows: get ... pythonelasticsearchelasticsearch-dsl sajjad zaidi 169 asked dec 15, 2022 at 13:03","['python', 'elasticsearch', 'elasticsearch-dsl']",en,elasticsearchdel intervals query using library make elastic search queries says supports intervals query find good example could help making query query follows get pythonelasticsearchelasticsearchdel salad said asked dec
66"how do i read the seven segment font(ocr)? i have been working on extracting text from images, specifically focusing on seven-segment fonts, using .net. unfortunately, my attempts with popular libraries like tesseract and ironocr have been ... .net.net-coreocrtesseractseven-segment-display kanet punit 97 asked dec 15, 2023 at 16:46","['.net', '.net-core', 'ocr', 'tesseract', 'seven-segment-display']",en,read seven segment fontocr working extracting text images specifically focusing sevensegment fonts using net unfortunately attempts popular libraries like tesseract ironic netnetcoreocrtesseractsevensegmentdisplay janet unit asked dec
67"why does randomforestclassifier not support missing values while decisiontreeclassifier does in scikit-learn 1.3? in the latest scikit-learn release (1.3), it was announced that decisiontreeclassifier now supports missing values. the implementation evaluates splits with missing values going either to the left or ... scikit-learnrandom-forestmissing-datadecision-tree datajanitor 1,795 asked jun 30, 2023 at 15:37","['scikit-learn', 'random-forest', 'missing-data', 'decision-tree']",en,randomforestclassifier support missing values decisiontreeclassifier spiritlearn latest spiritlearn release announced decisiontreeclassifier supports missing values implementation evaluates splits missing values going either left spiritlearnrandomforestmissingdatadecisiontree datajanitor asked jun
68"unable to create aws lambda layer: ""ssl validation failed ... eof occurred in violation of protocol (_ssl.c:2423)"" i am trying to create a layer based on the ready-made zip file here: https://github.com/diegoparrilla/headless-chrome-aws-lambda-layer the zip file is 80mb, which is larger than the maximum allowable ... amazon-web-servicesaws-lambdaaws-cli slothish1 159 asked aug 27, 2023 at 0:01","['amazon-web-services', 'aws-lambda', 'aws-cli']",en,unable create aws lambda layer ssl validation failed occurred violation protocol sslc trying create layer based readymade zip file zip file mb larger maximum allowable amazonwebservicesawslambdaawscli scottish asked aug
69"scriban property access returns empty string i have a class that looks like this: public class bominfo { public string partnumber { get; set; } public string revision { get; set; } } i have scriban parse and render calls similar to this:... c#scriban roadierich 6,621 asked oct 23, 2023 at 19:57","['c#', 'scriban']",en,syrian property access returns empty string class looks like public class domino public string arnumber get set public string revision get set syrian parse render calls similar csyrian roadierich asked oct
70"checking if the date lie between two dates from a different column based on a unique id (account_number) i have a dataset which has an account number a billing cycle date and transaction date . every account should have first two occurrences for the billing cycle date and then the transaction date has to ... sassas-macro ezio_auditore 43 asked dec 11, 2023 at 17:12","['sas', 'sas-macro']",en,checking date lie two dates different column based unique id accountnumber dataset account number billing cycle date transaction date every account first two occurrences billing cycle date transaction date passesmacro zioauditory asked dec
71"python/pyspark - programmatically send json_string column to rest api i have a dataframe which i stream in using spark structured streaming .readstream(): id json_data 123 {color: ""red"", value: ""#f00""} 125 {color: ""blue"", value: ""#f45&... pysparkdatabricksspark-structured-streaming itachi07 53 asked apr 23, 2024 at 10:13","['pyspark', 'databricks', 'spark-structured-streaming']",en,pythonspark programmatically send sonstring column rest api dataframe stream using spark structured streaming readstream id sondata color red value f color blue value f pysparkdatabrickssparkstructuredstreaming tachi asked apr
72"how can i set a default value for a field in a django model? suppose i have a model: class somemodel(models.model): id = models.autofield(primary_key=true) a = models.charfield(max_length=10) b = models.charfield(max_length=7) currently i am using ... pythondjangodjango-modelsdjango-admin yuval adam 165k asked apr 16, 2009 at 12:13","['python', 'django', 'django-models', 'django-admin']",en,set default value field tango model suppose model class somemodelmodelsmodel id modelsoutfieldprimarykeytrue modelscharfieldmaxlength b modelscharfieldmaxlength currently using pythondjangodjangomodelsdjangoadmin rural adam k asked apr
73"html agility pack get all elements by class i am taking a stab at html agility pack and having trouble finding the right way to go about this. for example: var findclasses = _doc.documentnode.descendants(""div"").where(d => d.attributes.... c#htmlhtml-agility-pack adam 3,665 asked dec 7, 2012 at 21:15","['c#', 'html', 'html-agility-pack']",en,html agility pack get elements class taking stab html agility pack trouble finding right way go example var findclasses docdocumentnodedescendantsdivwhered dattributes chtmlhtmlagilitypack adam asked dec
74"background image not showing up with react + tailwindcss im trying to use tailwind with react to show a background image. my config is like the follow: const white_bg = require(""../../assets/images/wave_light.svg""); // import using relative path ... htmlcssreactjstailwind-css fernando correia 151 asked nov 8, 2020 at 19:40","['html', 'css', 'reactjs', 'tailwind-css']",en,background image showing react tailwindcss trying use tailwind react show background image config like follow const whitebg requireassetsimageswavelightsvg import using relative path htmlcssreactjstailwindcss fernando correct asked nov
75"how can i make my sticky navbar stay at the front in chakra-ui i am using chakra-ui to create a ui for my nextjs project, and am struggling to get the navbar working correctly. it is fixed correctly as well as the mobile nav menu but the menu sits in front of the ... javascriptcssreactjschakra-ui hubertblu 829 asked jan 7, 2022 at 19:26","['javascript', 'css', 'reactjs', 'chakra-ui']",en,make sticky navbar stay front charaui using charaui create ui next project struggling get navbar working correctly fixed correctly well mobile nav menu menu sits front javascriptcssreactjschakraui hubertblu asked jan
76"nextjs dev server constantly keep disconnecting problem i have a nextjs project that i am currently working on, its smooth sailing but every once in a while, whenever i update my code there has been random occurences of my dev server disconnecting ... javascriptnext.js salm00n 163 asked aug 24, 2023 at 13:47","['javascript', 'next.js']",en,next dev server constantly keep disconnecting problem next project currently working smooth sailing every whenever update code random occurrences dev server disconnecting javascriptnextjs salen asked aug
77"how to change the terminal title i'm currently using hyper terminal on a mac, but this question also applies to other types of terminals, e.g. iterm how do you change the terminal title from username@devicename:~ into just ~ or zsh. ... macosterminalzshhypertermvercel-hyper-terminal joseph k. 1,223 asked oct 13, 2017 at 2:53","['macos', 'terminal', 'zsh', 'hyperterm', 'vercel-hyper-terminal']",en,change terminal title currently using hyper terminal mac question also applies types terminals eg term change terminal title usernamedevicename zh macosterminalzshhypertermvercelhyperterminal joseph k asked oct
78"values in the list of dictionary showing none i have a list of tuple: x = [('router_1', '0/1', '0/4', 'router_2'), ('router_1', '0/2', '0/4', 'router_3'), ('router_4', '0/1', '0/5', 'router_5'), ('router_4', '0/2', '0/5', 'router_6'... pythondictionary karim gamil 1 asked mar 19, 2024 at 2:32","['python', 'dictionary']",en,values list dictionary showing none list title x router router router router router router router router pythondictionary farm tamil asked mar
79"laravel not recognize my created custom class i created a custom file named zibalrequest.php in laravel controllers directory and here is my file : <?php namespace app\http\controllers; class zibalrequest { public function sendsmsotp($amount ... phplaravel seyyed mohammad hosseini 181 asked aug 6, 2024 at 15:11","['php', 'laravel']",en,travel recognize created custom class created custom file named zibalrequestphp travel controllers directory file php namespace apphttpcontrollers class zibalrequest public function sendsmsotpamount phplaravel seed mohammad hosseini asked aug
80"export wit xml failed i was trying to export a wit xml from visual studio 2019 - professional but i got the message as the attached snapshot error exporting work item type definition: the feature is disabled.... i was ... azure-devops dominic bowers 1 asked feb 7, 2024 at 12:09",['azure-devops'],en,export wit xml failed trying export wit xml visual studio professional got message attached snapshot error exporting work item type definition feature disabled azuredrops dominic powers asked feb
81"how to display nsmutableattributedstring in text view in swiftui? given a string, the * quick * brown * fox * jumps * over * the * lazy * dog, i'm applying font modifiers as follows in order to style all occurrences of asterisk differently than the rest of the text. ... swiftswiftuiattributedstring batman 2,458 asked oct 5, 2023 at 8:23","['swift', 'swiftui', 'attributedstring']",en,display nsmutableattributedstring text view swift given string quick brown fox jumps lazy dog applying font modifiers follows order style occurrences asterisk differently rest text swiftswiftuiattributedstring batman asked oct
82"choose for which device the preview is shown, jetpack compose in the view system we could choose xml preview for different devices, but i could not find a way to choose preview device for jetpack compose. how do we set preview for different devices while using ... androidpreviewandroid-jetpack-compose sparsh dutta 3,018 asked may 27, 2021 at 14:26","['android', 'preview', 'android-jetpack-compose']",en,choose device preview shown setback compose view system could choose xml preview different devices could find way choose preview device setback compose set preview different devices using androidpreviewandroidsetbackcompose sparse data asked may
83"ionic framework react app build failing due to invalid java version [duplicate] i am trying to publish my app to the app store using the ionic framework, but whenever i try to build on ionic, i get the following error: an exception occurred applying plugin request [id: 'com.... javaandroidionic-framework henhen 1,207 asked 2 days ago","['java', 'android', 'ionic-framework']",en,ionic framework react app build failing due invalid java version duplicate trying publish app app store using ionic framework whenever try build ionic get following error exception occurred applying plugin request id com javaandroidionicframework hence asked days ago
84"no mssql-jdbc_auth-8.2.1.x64 in java.library.path i'm trying to connect to sql db in my maven project, but keep getting following exception: ""com.microsoft.sqlserver.jdbc.sqlserverexception: this driver is not configured for integrated ... javasql-servermavenexceptionjdbc liu 61 asked apr 9, 2020 at 8:35","['java', 'sql-server', 'maven', 'exception', 'jdbc']",en,sqljbcauthx javalibrarypath trying connect sql db project keep getting following exception commicrosoftsqlserverjbcsqlserverexception driver configured integrated javasqlservermavenexceptionjdbc liu asked apr
85"how to get a streaming output from a llama 2 model? i am unable to parse the streaming output from a llama model deployed on sage maker? can someone help me with this?? tried to read bytes array and parse it. however, the output is returned together ... amazon-web-servicesllama irits anna mathew 11 asked sep 19, 2023 at 15:53","['amazon-web-services', 'llama']",en,get streaming output lama model unable parse streaming output lama model deployed sage maker someone help tried read bytes array parse however output returned together amazonwebservicesllama iris anna matthew asked sep
86"how to remove or identify unused packages from flutter to reduce size of the project? i used some packages that i no longer need in my flutter project, namely the wilddog_auth and wilddog_sync, i can remove the imports from pubspec.yaml file, and my dart files (aka removing import '... flutterflutter-dependenciesbundling-and-minificationflutter-packages aero wang 9,345 asked aug 20, 2018 at 8:28","['flutter', 'flutter-dependencies', 'bundling-and-minification', 'flutter-packages']",en,remove identify unused packages clutter reduce size project used packages longer need clutter project namely wilddogauth wilddogsync remove imports pubspecyam file dart files aka removing import flutterflutterdependenciesbundlingandminificationflutterpackages aero wang asked aug
87"psql non-breaking spaces and spase in ::money there is a program in flask and postgresql. some of the data from the number is converted into money. on windows, the thousands separator is , this is visible in the browser console, but ... htmlpostgresqlflask dutik 27 asked nov 22, 2023 at 6:49","['html', 'postgresql', 'flask']",en,sql nonbreaking spaces space money program flask postgresql data number converted money windows thousands separator nbsp visible browser console htmlpostgresqlflask duty asked nov
88"if two consecutive columns are equal and adjacent column has variations find those entries for excel, i want to compare all consecutive cells in a column with the values in adjacent column. if there is a variation for same consecutive cells having same values, i want to copy the entire row ... excelvbaduplicatespowerquery ajit dohaliya 11 asked nov 24, 2023 at 14:59","['excel', 'vba', 'duplicates', 'powerquery']",en,two consecutive columns equal adjacent column variations find entries excel want compare consecutive cells column values adjacent column variation consecutive cells values want copy entire row excelvbaduplicatespowerquery ait dohaliya asked nov
89"uncaught syntaxerror: the requested module './add.js' does not provide an export named 'add' i am trying to learn es6 imports and exports but i ran into an error that is not letting me import my module. i also tried import .. from 'add.js' without ./ but still no luck. uncaught syntaxerror: ... javascriptecmascript-6 liga 3,439 asked feb 8, 2019 at 10:57","['javascript', 'ecmascript-6']",en,caught syntaxerror requested module addjs provide export named add trying learn es imports exports ran error letting import module also tried import addjs without still luck caught syntaxerror javascriptecmascript liga asked feb
90"nextjs - google maps dynamically change the color of markers in my nextjs app, i load my map via the @googlemaps/js-api-loader package. i have a list of locations i want to plot on the map, and at the same time have a list of them disabled on the left side of ... javascriptgoogle-mapsnext.jsgoogle-maps-api-3google-maps-advanced-marker-element phoebus 1,333 asked may 5, 2024 at 16:22","['javascript', 'google-maps', 'next.js', 'google-maps-api-3', 'google-maps-advanced-marker-element']",en,next google maps dynamically change color markers next app load map via googlemapsjsapiloader package list locations want plot map time list disabled left side javascriptgooglemapsnextgooglemapsapigooglemapsadvancedmarkerelement phoebe asked may
91"using pytest and mongoengine, data is created in the main database instead of a test one i've installed these packages: python -m pip install pytest pytest-django and created a fixture: # core/services/tests/fixtures/checkout.py import pytest from bson import objectid from datetime ... pythondjangomongodbpytestmongoengine amir shabani 4,257 asked yesterday","['python', 'django', 'mongodb', 'pytest', 'mongoengine']",en,using bytes mongoengine data created main database instead test one installed packages python pip install bytes bytestango created fixture coreservicestestsfixturescheckoutpy import bytes son import objectid daytime pythondjangomongodbpytestmongoengine amir shaman asked yesterday
92python amazon automation chromedriver discovery error import unittest from selenium import webdriver from selenium.webdriver.chrome.options import options from selenium.webdriver.common.by import by from selenium.webdriver.common.keys import keys from ... pythonselenium-webdriverautomation oğuzhan bilir 1 asked 3 hours ago,"['python', 'selenium-webdriver', 'automation']",en,python amazon automation chromedriver discovery error import unites selenium import webdriver seleniumwebdriverchromeoptions import options seleniumwebdrivercommonby import seleniumwebdrivercommonkeys import keys pythonseleniumwebdriverautomation ogthan blir asked hours ago
93"nlog layout renderer for aspnet-user-identity not showing in log i am trying to get the user identity from asp.net to log using nlog but it is not working. nothing is logged for {aspnet-user-identity} or {aspnet-request-ip}. i have the layout renders in my nlog.... asp.net-corenlog esr124 61 asked jun 14, 2024 at 5:14","['asp.net-core', 'nlog']",en,log layout rendered spentuseridentity showing log trying get user identity aspnet log using log working nothing logged spentuseridentity spentrequestip layout renders log aspnetcorenlog esr asked jun
94"how to convert a pdf to grayscale from command line avoiding to be rasterized? i'm trying to convert to grayscale this pdf: https://dl.dropboxusercontent.com/u/10351891/page-27.pdf ghostscript (v 9.10) with pdfwrite device fails with a ""unable to convert color space to gray, ... pdfghostscriptgrayscalepdf-conversionpdf-manipulation panda 285 asked nov 21, 2013 at 18:07","['pdf', 'ghostscript', 'grayscale', 'pdf-conversion', 'pdf-manipulation']",en,convert pdf grayscale command line avoiding rasterized trying convert grayscale pdf postscript v pdfwrite device fails unable convert color space gray pdfghostscriptgrayscalepdfconversionpdfmanipulation panda asked nov
95"astrojs pagination `getstaticpaths()` route pattern was matched, but no matching static path was found for requested path i am writing a simple astro blog application my structure is like [lang] [chapter] [page] route is like. en/tasmania/things-to-do.mdx or hi/nsw/currentfestivals.mdx i'm getting an error when trying to ... paginationastrojsdynamic-routing user3176609 1 asked sep 22, 2023 at 23:55","['pagination', 'astrojs', 'dynamic-routing']",en,astros imagination getstaticpaths route pattern matched matching static path found requested path writing simple astro blog application structure like lang chapter page route like entasmaniathingstodomdy hinswcurrentfestivalsmdy getting error trying paginationastrojsdynamicrouting user asked sep
96"finding standing off values in a column i'm trying to build a database that would help me with technical analysis. but currently i can't move past one hurdle - how to find standing off value in a column? i don't really even know where to ... sqlsql-server ormrinn 3 asked dec 2, 2023 at 20:26","['sql', 'sql-server']",en,finding standing values column trying build database would help technical analysis currently cannot move past one hurdle find standing value column really even know sqlsqlserver ormrinn asked dec
97"handling serial communication for data acquisition in matlab i need to capture data from a sensing device from serial port using matlab. the program needs to read 500 miliseconds of data (sampled at 1000 hz) and stay idle until a new data package arrives with ... matlabserial-porthandlersensorsdata-acquisition joardemu85 1 asked may 12, 2024 at 9:09","['matlab', 'serial-port', 'handler', 'sensors', 'data-acquisition']",en,handling serial communication data acquisition atlas need capture data sensing device serial port using atlas program needs read milliseconds data sampled hz stay idle new data package arrives matlabserialporthandlersensorsdataacquisition joardemu asked may
98"transforming a parenthesized string of numbers to a tree i am developing a function to transform a parenthesized string of numbers to a tree. so, for example, treefromstring ""((1)((3)(4)))"" == right (nd (lf 1) (nd (lf 3) (lf 4))) this is my ... parsinghaskelltree f. zer 1,279 asked nov 18, 2023 at 13:15","['parsing', 'haskell', 'tree']",en,transforming parenthesized string numbers tree developing function transform parenthesized string numbers tree example treefromstring right nd lf nd lf lf parsinghaskelltree f zer asked nov
99"ms access form size maximised in ms access i have several forms, and when i start them, they are always maximised in size. they take up the whole page, although the design view shows that they should be a lot smaller. i would ... ms-access-forms kingsley obeng 150 asked apr 2, 2024 at 7:43",['ms-access-forms'],en,ms access form size maximise ms access several forms start always maximise size take whole page although design view shows lot smaller would msaccessforms kingsley asked apr
100"azure swa cli localhost:4280 is not working i want to build a local development environment for azure static web apps using swa cli. the client is a blazor wasm. i installed swa cli successfully using the command: npm install -g @azure/static-... swa-cli emad gabriel 3,707 asked may 20, 2024 at 16:34",['swa-cli'],en,azure swa cli localhost working want build local development environment azure static web apps using swa cli client blazon installed swa cli successfully using command num install g azurestatic swacli mad gabriel asked may
101"function interposition: about the use of a static function variable i want to interpose a library function from a third party, using ld_preload, and i have seen the following code pattern in a lot of places: void interposed_func() { static void(*real_func)() = ... cgccfunction-interposition abu 12.4k asked oct 2, 2023 at 13:21","['c', 'gcc', 'function-interposition']",en,function interpolation use static function variable want interpose library function third party using ldpreload seen following code pattern lot places void interposedfunc static voidrealfunc cgccfunctioninterpolation abu k asked oct
102"failed to flatten xml for resource 'invite_msg' with error: invalid unicode escape sequence in string iam tying to translate using the translate editor but keep on getting the following build error task :app:mergedebugresources c:\users\ralph\documents\server apps \apps \updated 25-10-2023\android ... android ralph douglas 1 asked dec 5, 2023 at 15:07",['android'],en,failed flatter xml resource invitemsg error invalid unicode escape sequence string iam tying translate using translate editor keep getting following build error task appmergedebugresources cusersralphdocumentsserver apps apps updated android android ralph douglas asked dec
103"how to get elapsed time of expo video? im using the expo-video-player package, and went to get the elapsed time of when a video is played. <expovideoplayer videoprops={{ resizemode: video.resize_mode_stretch, source: { ... reactjsreact-nativevideoexpo jniuk 163 asked jul 14, 2023 at 19:08","['reactjs', 'react-native', 'video', 'expo']",en,get elapsed time expo video using expovideoplayer package went get elapsed time video played expovideoplayer videoprops resizemode videoresizemodestretch source reactjsreactnativevideoexpo nick asked jul
104"how can i remove a constant alias in powershell? how can i remove a constant alias in powershell? i have tried some solutions, but i still get the same error. i tried to remove the ""sl"" alias, but i received an error message saying ""... powershell user21822818 21 asked may 5, 2023 at 5:29",['powershell'],en,remove constant alias powershell remove constant alias powershell tried solutions still get error tried remove sl alias received error message saying powershell user asked may
105"spring data jdbc and child entity equality i’m studying spring data jdbc through maciej walkowiak’s video (https://www.youtube.com/watch?v=ccxbxdapdmo), which presents a movie aggregate root with a one-to-many relationship to rental entities. ... javaspringdomain-driven-design thenikki1 153 asked yesterday","['java', 'spring', 'domain-driven-design']",en,spring data jbc child entity equality studying spring data jbc marie walkowiaks video presents movie aggregate root onetomany relationship rental entities javaspringdomaindrivendesign thenikki asked yesterday
106"how are some functions in privateframeworks not usable from non-apple signed binaries? i know that code signing (and entitlements, plists, etc.) affects launching of binaries, or getting a task port(for debugger), but i didn't know they affect private library function calling as well. ... xcodemacoscode-signingcode-signing-entitlements hym3242 166 asked may 10, 2024 at 8:22","['xcode', 'macos', 'code-signing', 'code-signing-entitlements']",en,functions privateframeworks usable nonapple signed binaries know code signing entitlement lists etc affects launching binaries getting task portfor debugger know affect private library function calling well xcodemacoscodesigningcodesigningentitlement asked may
107"c++ using extern c library, unexpected memory leak i have created a simple c library is generated by one .c and one .h file. // test.c #include ""test.h"" #include ""stdlib.h"" void getarray(int * array) { array = (int *) calloc(2, ... c++cmemory-managementmemory-leaksextern-c tucker 101 asked dec 1, 2023 at 19:07","['c++', 'c', 'memory-management', 'memory-leaks', 'extern-c']",en,c using extra c library unexpected memory leak created simple c library generated one c one h file testc include testh include stlbh void getawayint array array int called cmemorymanagementmemoryleaksexternc tucker asked dec
108"psycopg2 transfer data from one database to another i am trying to move data from one database (db1) to another (db2). after a few attempts, i came up with the code below, but it is too slow. according to my estimations, data transferring will take +7k ... pythonpostgresqlpsycopg2 иван иваныч 57 asked aug 14, 2023 at 19:29","['python', 'postgresql', 'psycopg2']",en,psycopg transfer data one database another trying move data one database db another db attempts came code slow according estimation data transferring take k pythonpostgresqlpsycopg ivan ivanych asked aug
109"laravel ldap always returning invalid email/password i'm using this pseudo code with valid credentials on my side, but i always get an invalid password or email when i try logging in, what should i do to fix this? if(isset($_post['username']) &&... phplaravel hdhdhdhdhdhdjfjfj 1 asked apr 19, 2024 at 16:20","['php', 'laravel']",en,travel lap always returning invalid emailpassword using pseudo code valid credentials side always get invalid password email try logging fix ifassetpostusername phplaravel hdhdhdhdhdhdjfjfj asked apr
110"passing docker environment variables to .net core i've followed this article and the code on the github doesn't compile, tutorial is outdated i think. (configuration = builder.build();) throws error. so how can i access env passed from docker? docker-... c#dockerasp.net-core appdeveloper 2,220 asked oct 10, 2019 at 8:51","['c#', 'docker', 'asp.net-core']",en,passing decker environment variables net core followed article code github compile tutorial outdated think configuration builderbuild throws error access env passed decker decker cdockeraspnetcore appdeveloper asked oct
111"increase width of rmarkdown theme 'readthedown' i have a question about rmarkdown. i use this theme, 'readthedown' and i would like to increase the width of the page because i have a huge grey right panel which is not used. i tried something in a ... cssrr-markdownthemes nimliug 465 asked sep 2, 2021 at 17:28","['css', 'r', 'r-markdown', 'themes']",en,increase width smackdown theme readthedown question smackdown use theme readthedown would like increase width page huge grey right panel used tried something cssmarkdownthemes nimliug asked sep
112"how to fix my game being stuck in a loop after entering an invalid direction [closed] i'm working on a project for school, and i need to create a text-based adventure game. what i have so far is """"""#introduction to the game"""""" from django.template.... python tiffany peters 11 asked apr 19 at 21:16",['python'],en,fix game stuck loop entering invalid direction closed working project school need create textbased adventure game far introduction game tangotemplate python tiffany peters asked apr
113"troubleshooting dropdown display of enum values in asp.net core mvc i want to allow the user to download the report, when it is approved by a supervisor. at the moment, i'm working with manager account, where he can check many reports and change their state to either ... c#model-view-controllerasp.net-core-mvc saraphin34 37 asked nov 3, 2022 at 11:44","['c#', 'model-view-controller', 'asp.net-core-mvc']",en,troubleshooting dropdown display num values aspnet core mvc want allow user download report approved supervisor moment working manager account check many reports change state either cmodelviewcontrollersnetcoremvc saraphin asked nov
114"android studio - theme switch i am making a simple app in android studio with kotlin for a school assignment and im having an issue.. i have mainactivity along with others and also settingsactivity... inside settings activity i ... androidkotlin przgibaklo 33 asked dec 4, 2023 at 18:29","['android', 'kotlin']",en,android studio theme switch making simple app android studio koeln school assignment issue inactivity along others also settingsactivity inside settings activity androidkotlin przgibaklo asked dec
115"how to specify default values when parsing json in go i want to parse a json object in go, but want to specify default values for fields that are not given. for example, i have the struct type: type test struct { a string b string c string } ... jsongo jw. 2,701 asked may 25, 2015 at 20:18","['json', 'go']",en,specify default values parsing son go want parse son object go want specify default values fields given example struct type type test struct string b string c string song jw asked may
116"how to create a mask based on points coordinates? starting from this situation: i would like to create a boolean mask where all external points are considered as true while all internal point are false. something like this : the objective would be ... pythonmathmatrixsubsetnumpy-slicing certes 159 asked jul 4, 2024 at 10:56","['python', 'math', 'matrix', 'subset', 'numpy-slicing']",en,create mask based points coordinates starting situation would like create boolean mask external points considered true internal point false something like objective would pythonmathmatrixsubsetnumpyslicing ceres asked jul
117"write vault secret path if no vault_addr is present multiple secrets are resolved with hashicorp vault lookup plugin from the group_vars. the goal is to resolve the secrets if the playbook is run in the build pipeline. if the playbook is run in a local ... ansiblejinja2ansible-inventory in0cent 481 asked sep 5, 2023 at 9:08","['ansible', 'jinja2', 'ansible-inventory']",en,write vault secret path vaultaddr present multiple secrets resolved hashicorp vault lookup plugin groupcars goal resolve secrets playbook run build pipeline playbook run local ansiblejinjavisibleinventory incent asked sep
118"re-rendering layout without render of child component in react with a code such as <layout pagename={pagename} rightmenu={rightmenu}> <organizationdashboardmembersmetrics layoutcallback={layoutcallback} /> </layout> page name is a simple ... javascriptreactjs laurent 2,178 asked jan 25, 2024 at 9:35","['javascript', 'reactjs']",en,rerendering layout without render child component react code page name simple javascriptreactjs laurent asked jan
119"trying to create date range filter in my pysimplegui table first of all wishing all of you successful 2024 year! im trying to create a date range sortable filter in my pysimplegui table app, but unfortunately im getting this error all the time: traceback (... datetimefilterjquery-ui-sortablepysimplegui vladimirplamenovkostov 1 asked jan 7, 2024 at 18:18","['datetime', 'filter', 'jquery-ui-sortable', 'pysimplegui']",en,trying create date range filter pysimplegui table first wishing successful year trying create date range sortable filter pysimplegui table app unfortunately getting error time traceback datetimefilterjqueryuisortablepysimplegui vladimirplamenovkostov asked jan
120"when using fmtlib, `unicode support requires compiling with /utf-8` compiling error happens [closed] i have a program encoding with gb2312 with some chinese words. and i use fmtlib in it. but when compiling under msvc/cmake, then errors come out as shown https://github.com/fmtlib/fmt/blob/master/... c++ f1msch 673 asked yesterday",['c++'],en,using fmtlib unicode support requires compiling utf compiling error happens closed program encoding gb chinese words use fmtlib compiling svcmake errors come shown c fmuch asked yesterday
121"how can i navigate pragmatically in sveltekit? using sveltekit, after authenticating a user, how can i redirect to another internal page (in this case, simply on '/')? i've already tried goto() and redirect(), but the first gives a usage error on ... navigationsveltesveltekitnavigator teo7 81 asked jul 15, 2023 at 21:21","['navigation', 'svelte', 'sveltekit', 'navigator']",en,navigate dramatically sveltekit using sveltekit authentication user redirect another internal page case simply already tried goto redirect first gives usage error navigationsveltesveltekitnavigator teo asked jul
122"i am confused on how to use the grid templates to align images in a segment i am doing an assignment for my school. i am stuck here, please help! this is the segment that i need to built here is my html code: <!doctype html> <html lang=""en""> <head>... htmlcss moinul haque 3 asked feb 13, 2024 at 23:27","['html', 'css']",en,confused use grid templates align images segment assignment school stuck please help segment need built html code htmlcss minus aque asked feb
123"how do i determine the order of ""properties"" with swagger-autogen in node.js? for some reason, swagger-autogen is reversing the order of my properties in my swagger.json output file. for example, i have a simple 'user' mongoose schema set up with only 'username' and 'password' ... node.jspropertiesswaggermongoose-schema jade8855 13 asked may 9, 2022 at 22:06","['node.js', 'properties', 'swagger', 'mongoose-schema']",en,determine order properties daggerantigen nodejs reason daggerantigen reversing order properties daggerson output file example simple user mongoose schema set username password nodejspropertiesswaggermongooseschema jade asked may
124"modulenotfounderror: no module named 'ruptures.datasets' probably i am opening the 1.000.000 question to a modul not found error. but i installed ruptures with pip install ruptures, but somehow when i run my script i get the following error: ----------------... python pv8 6,280 asked oct 26, 2023 at 8:20",['python'],en,modulenotfounderror module named rupturedatasets probably opening question model found error installed rupture pip install rupture somehow run script get following error python pv asked oct
125"dev containers: change default workspace folder name when using the dev containers:new dev container option the default workspace folder that is created is named after the dev container type. for example if you choose the node.js & typescript type, ... vscode-devcontainer vladatnyc 41 asked oct 16, 2023 at 15:18",['vscode-devcontainer'],en,dev containers change default workspace folder name using dev containersnew dev container option default workspace folder created named dev container type example choose nodejs typescript type uscodedevcontainer vladatnyc asked oct
126"wrapping a dll into my own dll to modify the values passed to it im trying to wrap the dll ""dbghelp.dll"", mainly the function ""imagentheader"", into my own dll, that i can then place it into notepad++, so it uses my wrapped dbghelp.dll, instead ... c++cdll thecustomfhd 31 asked jan 25, 2024 at 22:45","['c++', 'c', 'dll']",en,wrapping modify values passed trying wrap dbghelpall mainly function imagentheader place noted uses wrapped dbghelpall instead ccall thecustomfhd asked jan
127"how to use prisma adapter next auth in route handlers how to use next auth in next js 13 with prisma adapter? it keep throw error.in next auth prisma adapter dosc only support pages/api/ but i use the app/api. i already tried a few code but this 2 only ... next.jsprismanext-auth dwi setyo aji 123 asked jul 26, 2023 at 13:29","['next.js', 'prisma', 'next-auth']",en,use prism adapter next auth route handlers use next auth next js prism adapter keep throw errorin next auth prism adapter doc support pagesapi use appapi already tried code nextjsprismanextauth doi set aji asked jul
128"issues with product detection and consistent person ids using yolov8 and deepsort i'm working on a real-time object tracking system using yolov8 for object detection and deepsort for tracking. the goal is to detect both customers (persons) and products, and assign each person a ... pythonreal-timeyolov8 akash s 1 asked apr 21 at 8:58","['python', 'real-time', 'yolov8']",en,issues product detection consistent person ids using color delsort working realtime object tracking system using color object detection delsort tracking goal detect customers persons products assign person pythonrealtimeyolov ndash asked apr
129"split dataframe into multiple dataframes by grouping columns i have a dataframe of expression data where gene are rows and columns are samples. i also have a dataframe containing metadata for each sample in the expression dataframe. in reality my expr dataframe ... rdataframedplyrbioinformatics kenn 83 asked dec 21, 2023 at 18:06","['r', 'dataframe', 'dplyr', 'bioinformatics']",en,split dataframe multiple dataframes grouping columns dataframe expression data gene rows columns samples also dataframe containing metadata sample expression dataframe reality expr dataframe rdataframedplyrbioinformatics keen asked dec
130"why does a custom uibutton image does not resize in interface builder? why does a custom uibutton image not resize with the button? i set its view mode to scale to fill in interface builder, but unlike a uiimageview image, it doesn't respect that setting. am i looking ... ioscocoa-touchuibuttoninterface-builder willc2 39.7k asked jun 30, 2009 at 10:44","['ios', 'cocoa-touch', 'uibutton', 'interface-builder']",en,custom button image resize interface builder custom button image resize button set view mode scale fill interface builder unlike uiimageview image respect setting looking ioscocoatouchuibuttoninterfacebuilder k asked jun
131"backslash escape character in command echo can anyone explain why \n is not working as line break? [user1@localhost ~]$ echo -e a\nb\nc anbnc bashquotes joe 33 asked aug 22, 2023 at 21:03","['bash', 'quotes']",en,backlash escape character command echo anyone explain n working line break userlocalhost echo e anbnc abc bashquotes joe asked aug
132"how can i keep the top bar stationary in jetpack compose when the keyboard is displayed? i'm encountering an issue with the layout behavior in a chat screen using jetpack compose. i have a scaffold containing a topappbar, a bottombar with a textfield, and a lazycolumn between them for the ... androidandroid-jetpack-composeandroid-jetpack-compose-material3 andyshubh 43 asked dec 23, 2023 at 10:13","['android', 'android-jetpack-compose', 'android-jetpack-compose-material3']",en,keep top bar stationary setback compose keyboard displayed encountering issue layout behavior chat screen using setback compose scaffold containing topappbar bottombar textfield lazycolumn androidandroidsetbackcomposeandroidsetbackcomposematerial andyshubh asked dec
133makecachematrix r tutorial from coursera i have been trying to complete the 2nd assignment for the r programming course from coursera. this assignment consists of writing the function makecachematrix() which returns the inverse of a matrix. ... rmatrix-inverse marcos 41 asked apr 20 at 4:24,"['r', 'matrix-inverse']",en,makecachematrix r tutorial course trying complete nd assignment r programming course course assignment consists writing function makecachematrix returns inverse matrix matrixinverse marcos asked apr
134"how to change axis labels of a plotly barplot im trying to plot a waterfall plot where every single bar is a different subject, and its height is the value that i measuring. i would like to change x axis labels to have n values (0, 50, 100,... ... rplotlybar-chart ayoubinsky 63 asked feb 28, 2024 at 13:05","['r', 'plotly', 'bar-chart']",en,change axis labels plot ballot trying plot waterfall plot every single bar different subject height value measuring would like change x axis labels n values rplotlybarchart ayoubinsky asked feb
135"can't align things the way i want currently trying to create something kind of like a about me page, i'm currently having some issues aligning things properly. my current issue is, neither of the bottom boxes as shown in the pic don't ... htmlcss skyla 15 asked apr 14, 2024 at 17:59","['html', 'css']",en,cannot align things way want currently trying create something kind like page currently issues aligning things properly current issue neither bottom boxes shown pic htmlcss skyl asked apr
136"allow windows ad group to own a sql job the sql agent jobs sits above the user level and requires a login to be assigned to the owner. but it doesn't take a group login as an accepted parameter. i need to use the windows ad group as owner ... sql-serversql-server-2012ssmssql-agent hackingwiz 69 asked dec 21, 2021 at 9:09","['sql-server', 'sql-server-2012', 'ssms', 'sql-agent']",en,allow windows ad group sql job sql agent jobs sits user level requires login assigned owner take group login accepted parameter need use windows ad group owner sqlserversserverssmssqlagent hackingwiz asked dec
137"laravel error while using breeze as extention error while running npm run build the erorr accour when i run npm run build][and i dont understand how to fix this prblem, can anyone help me, im running it on vscode laravel procject with laravel:... node.jslaravelbreeze muhammad rozy 1 asked 2 days ago","['node.js', 'laravel', 'breeze']",en,travel error using breeze extension error running num run build error actor run num run buildand understand fix problem anyone help running uscode travel project travel nodejslaravelbreeze muhammad roy asked days ago
138"manually create span with start and end timestamps - opentelemetry python i am trying to trace the execution of a task in celery through the publisher -> queue -> consumer lifecycle. i am using opentelemetry 1.16.0 in python 3.9.15 in order to instrument the ... pythonopen-telemetry matthew thomas 871 asked mar 13, 2023 at 23:48","['python', 'open-telemetry']",en,manually create span start end timestamp opentelemetry python trying trace execution task every publisher queue consumer lifecycle using opentelemetry python order instrument pythonopentelemetry matthew thomas asked mar
139"android close app on back button the application looks something like this: mainactivity -> useractivity -> detailsactivity. (approximate order of activities). i would like to close the application when the back button is clicked in ... android user2576401 asked oct 1, 2013 at 6:35",['android'],en,android close app back button application looks something like inactivity useractivity detailsactivity approximate order activities would like close application back button clicked android user asked oct
140"constraint violation in spring jpa while saving entity in the processorder method when i try saving the tacoorder entity it gives me this error jakarta.validation.constraintviolationexception: validation failed for classes [com.example.tacohouse.entities.... javaspringhibernatespring-mvcspring-data-jpa alpha 31 asked mar 19, 2024 at 10:03","['java', 'spring', 'hibernate', 'spring-mvc', 'spring-data-jpa']",en,constraint violation spring ja saving entity processorder method try saving tacoorder entity gives error jakartavalidationconstraintviolationexception validation failed classes comexampletacohouseentities javaspringhibernatespringmvcspringdataja alpha asked mar
141"chart.js 3.7.1 - how can i control the number of ticks on the y axis of a line chart? the data will always be integers between -10 and 10, including 0 so there could be a maximum of 21 'intervals' on the y axis. regardless of the data, i need the y axis to display from -10 to 10 (... chart.js3 kristy1024 71 asked mar 17, 2022 at 12:40",['chart.js3'],en,chartjs control number ticks axis line chart data always integers including could maximum intervals axis regardless data need axis display chartjs wrist asked mar
142"cursor moves at the end of text box after updating the first character to upper case tried many ways to fix the issue, but badly none of them worked. i tried updating the first character of the input string to upper case in a textbox, this working fine, but the cursor moves at the end ... javascriptreactjsreact-hooks unnikrishnan s 13 asked jan 1, 2024 at 15:23","['javascript', 'reactjs', 'react-hooks']",en,cursor moves end text box updating first character upper case tried many ways fix issue badly none worked tried updating first character input string upper case taxobox working fine cursor moves end javascriptreactjsreacthooks unnikrishnan asked jan
143"copy to clipboard using bash for windows how do i copy results from the commandline directly to the clipboard? on windows's cmd.exe i can do simply echo ""asd"" | clip and it pipes output to the clipboard. i tried to install xclip for that, ... windowscommand-linewindows-subsystem-for-linux marek lewandowski 3,401 asked mar 31, 2017 at 15:07","['windows', 'command-line', 'windows-subsystem-for-linux']",en,copy clapboard using bash windows copy results commanding directly clapboard windowss cmdexe simply echo asd clip pipes output clapboard tried install clip windowscommandlinewindowssubsystemforlinux mark lewandowski asked mar
144"how to create dynamic squares using flexbox? i am having a few difficulties setting up the dynamic portion of the sketch project i am doing. the idea that i want to implement next is that the amount of squares (divs) changes inside the ... javascriptcssdynamicflexboxresize kcolrehs 13 asked nov 3, 2022 at 13:24","['javascript', 'css', 'dynamic', 'flexbox', 'resize']",en,create dynamic squares using flexbox difficulties setting dynamic portion sketch project idea want implement next amount squares div changes inside javascriptcssdynamicflexboxresize kcolrehs asked nov
145"what would cause a js carousel to not work on ios & safari? i have a carousel that i built for a page based on this guide & it works fine on desktop non-ios browsers, so not at all on apple mobile devices (iphone & ipad). i can't share the url because ... javascripthtmlcsssafari jeff w 147 asked dec 9, 2022 at 0:35","['javascript', 'html', 'css', 'safari']",en,would cause js carousel work ios safari carousel built page based guide works fine desktop nonios browsers apple mobile devices iphone ipad cannot share url javascripthtmlcsssafari jeff w asked dec
146"how to remove microsoft-iis/8.5 header from response headers in a shared server i want to remove microsoft-iis/8.5 header. most of the tutorials online are suggesting to use iis manager to fix the issue, but my server provider is not allowing iis manager in their shared server. ... iisserverheaderresponsehosting gorlomi 11 asked mar 16, 2021 at 14:23","['iis', 'server', 'header', 'response', 'hosting']",en,remove microsoftiis header response headers shared server want remove microsoftiis header tutorials online suggesting use iis manager fix issue server provider allowing iis manager shared server iisserverheaderresponsehosting gorlomi asked mar
147"express-session | req.session always empty for every request even after created the problem is i cannot access the protected route even after logged in, because the middleware checks that there is no user session to access that protected route. express-session here is the session ... node.jsexpressauthenticationexpress-session agu 9 asked sep 17, 2023 at 18:21","['node.js', 'express', 'authentication', 'express-session']",en,expresssession reqsession always empty every request even created problem cannot access protected route even logged middleware checks user session access protected route expresssession session nodejsexpressauthenticationexpresssession agu asked sep
148"how to display mulitple dropzone.js preview records in one row using a preview template i am using dropzone.js to display images for my application. the app uses laravel, vue, and bootstrap. there can be as many as 40+ images for one record in my db so displaying one preview per row isn'... cssformatdisplaydropzone.jspreview amyb 21 asked oct 25, 2023 at 20:53","['css', 'format', 'display', 'dropzone.js', 'preview']",en,display multiple dropzonejs preview records one row using preview template using dropzonejs display images application app uses travel vue bootstrap many images one record db displaying one preview per row cssformatdisplaydropzonepreview amy asked oct
149"should i save blobserviceclient & blobcontainerclient for the life of my app? are blobserviceclient & blobcontainerclient lightweight like dbcontext so it's fine to instantiate them anytime needed? or do they take appreciable time to construct and therefore i should create ... azure-blob-storageazure-storage david thielen 33.2k asked jul 30, 2023 at 3:47","['azure-blob-storage', 'azure-storage']",en,save blobserviceclient blobcontainerclient life app blobserviceclient blobcontainerclient lightweight like context fine instantiate anytime needed take appreciable time construct therefore create azureblobstorageazurestorage david themen k asked jul
150"using cypress and vue.js, how can i find and select an element in a v-select dropdown? this is my code: <v-select label=""label"" v-model=""ccrcode"" ref=""ccrcode"" :items=""getdata"" item-text=""descwithcode"" ... vue.jsautomated-testscypressv-select mr.oxmanee 113 asked oct 9, 2019 at 7:00","['vue.js', 'automated-tests', 'cypress', 'v-select']",en,using cypress vuejs find select element vselect dropdown code vselect labellabel vmodelbarcode refbarcode itemsgeodata itemtextdescwithcode vueautomatedtestscypressvselect mroxmanee asked oct
151"i am running a job called sqltodb in data migration through batch file where i am running a query and storing that data into a database table info sparkcontext: running spark version 3.2.1 24/06/12 03:24:58 warn sparkconf: note that spark.local.dir will be overridden by the value set by theanger (vi spark local dirs in mesos/standalone/... javadatabaseapache-sparkproperties-file sravya gundu 1 asked jun 12, 2024 at 7:56","['java', 'database', 'apache-spark', 'properties-file']",en,running job called sqltodb data migration batch file running query storing data database table info sparkcontext running spark version warn sparkconf note sparklocaldir overridden value set theater vi spark local dies messstandalone javadatabaseapachesparkpropertiesfile savy undo asked jun
152"google calendar php api i am currently using the google calendar api for a web application. however, every hour, i am prompted with a link to verify quick-start access. details: i have created a new gmail id: [email protected] ... phpgoogle-apigoogle-calendar-apigoogle-oauthgoogle-api-php-client itsmemoriarty 145 asked jun 17, 2020 at 4:50","['php', 'google-api', 'google-calendar-api', 'google-oauth', 'google-api-php-client']",en,google calendar php api currently using google calendar api web application however every hour prompted link verify quickstart access details created new gmail id email protected phpgoogleapigooglecalendarapigoogleoauthgoogleapiphpclient itsmemoriarty asked jun
153"regex - extract all headers from markdown string i am using gray-matter in order to parse .md files from the file system into a string. the result the parser produces is a string like this: \n# clean-er reactjs code - conditional rendering\n\n## tl;... javascriptregexstringmatchmarkdown miha šušteršič 10.1k asked jan 21, 2022 at 13:04","['javascript', 'regex', 'string', 'match', 'markdown']",en,regex extract headers smackdown string using graymatter order parse md files file system string result parser produces string like n cleaner reacts code conditional renderingnn tl javascriptregexstringmatchmarkdown mica syoustersic k asked jan
154can't generate a proper qr [closed] import matplotlib import numpy as np import matplotlib.pyplot as plt from dataclasses import dataclass from pandas import read_csv from masking import masking @dataclass class lefttopfinderpattern: ... pythonqr-code mr.sigma2345 1 asked 18 hours ago,"['python', 'qr-code']",en,cannot generate proper qr closed import matplotlib import num problem import matplotlibpilot lt dataclasses import dataclass panda import readcsv masking import masking dataclass class lefttopfinderpattern pythoncode mrsigma asked hours ago
155"how can i override postgresql's gen_random_uuid() in rails? i want to prepend a string to the uuid generated by postgresql's gen_random_uuid() to use as the uuid for one of my models (it won't be the primary key). think like stripe's price and customer ids - &... ruby-on-railspostgresqlruby-on-rails-7pgcrypto supersaidso 69 asked oct 12, 2023 at 10:11","['ruby-on-rails', 'postgresql', 'ruby-on-rails-7', 'pgcrypto']",en,override postgresqls genrandomuuid rails want pretend string uuid generated postgresqls genrandomuuid use uuid one models primary key think like stripes price customer ids rubyonrailspostgresqlrubyonrailscrypto supersaidso asked oct
156"how to create a groovy function with stage and steps i have a jenkinsfile with a pipeline call that become longer and longer and i would like to create function from it to have better readability. see the jenkinsfile : def utils def setupenvironment() {... jenkins-groovy peterphonic 1,069 asked aug 31, 2023 at 14:55",['jenkins-groovy'],en,create groove function stage steps jenkinsfile pipeline call become longer longer would like create function better readability see jenkinsfile def def setupenvironment jenkinsgroove peterphonic asked aug
157"i want to make 15 concurrent calls to an api using promise.all( ) rather than successive calls. i can't figure out what i am doing wrong caveat: i'm learning to work with javascript promises and api calls, so i try to write the code in promise.then format as well as async / await, so i know how to use both. i have a container that i am ... javascriptasync-awaitpromisepromise.all rk3110 25 asked jun 29, 2023 at 9:04","['javascript', 'async-await', 'promise', 'promise.all']",en,want make concurrent calls api using promiseall rather successive calls cannot figure wrong caveat learning work javascript promises api calls try write code promisethen format well sync await know use container javascriptasyncawaitpromisepromiseall rk asked jun
158"c# '@' before a string [duplicate] possible duplicate: what's the @ in front of a string for .net? i found this in a c# study book directoryinfo dir = new directoryinfo(key.key.tostring() + @"":\""); the book however did not ... c#.net daniel 2,832 asked feb 2, 2011 at 19:53","['c#', '.net']",en,c string duplicate possible duplicate front string net found c study book directoryinfo dir new directoryinfokeykeystring book however cnet daniel asked feb
159"android ndk java.lang.unsatisfiedlinkerror: findlibrary returned null having the above error in your android jni app? read on... up front, i'll say that i've already solved this, in my own way, but i feel something in the android build system (perhaps regarding ... android-ndkjava-native-interface lee dixon 849 asked jan 27, 2012 at 18:08","['android-ndk', 'java-native-interface']",en,android nd javalangunsatisfiedlinkerror findlibrary returned null error android jni app read front say already solved way feel something android build system perhaps regarding androidndkjavanativeinterface lee dixon asked jan
160"unity3d camera rotation cut off after build i am trying to make unity 3d multiplayer 1st shooter game and i am working on the player movement. everything is fine when i run on unity editor, but when i build the game and play, the camera(1st ... unity-game-engine 정혜성 21 asked jan 13, 2024 at 4:55",['unity-game-engine'],en,unityd camera rotation cut build trying make unity multiplayer st shooter game working player movement everything fine run unity editor build game play camerast unitygameengine jeonghyeseong asked jan
161"cannot visualize google maps on android emulator using flutter i am developing an android/ios application using flutter. flutter doctor $ flutter doctor -v [√] flutter (channel stable, 3.16.1, on microsoft windows [version 10.0.19045.3693], locale en-us) • ... fluttergoogle-mapsandroid-emulator carlo benussi 175 asked dec 6, 2023 at 13:07","['flutter', 'google-maps', 'android-emulator']",en,cannot visualize google maps android emulator using clutter developing androidios application using clutter clutter doctor clutter doctor v clutter channel stable microsoft windows version locale enus fluttergooglemapsandroidemulator carlo benussi asked dec
162"how can i make kernel trainable= false and recurrent_kernel trainable = false using standard keras lstm i understand that using trainable = false, i can freeze all the weights of a specific layer. but i want to work on the components (kernel, recurrent_kernel and bias) of each layer as well. i want to ... pythonkeraslstmfreezetransfer binata roy 1 asked nov 2, 2023 at 1:05","['python', 'keras', 'lstm', 'freeze', 'transfer']",en,make kernel traceable false recurrentkernel traceable false using standard eras stm understand using traceable false freeze weights specific layer want work components kernel recurrentkernel bias layer well want pythonkeraslstmfreezetransfer binary roy asked nov
163"issue with uploading cover photo for lead generation form using php sdk i'm experiencing an issue with the facebook php sdk when trying to upload a cover photo for a lead generation form. despite following the sdk documentation and examples, i keep encountering this error ... facebook-graph-apifacebook-php-sdkfacebook-page murat colyaran 2,189 asked nov 29, 2023 at 10:07","['facebook-graph-api', 'facebook-php-sdk', 'facebook-page']",en,issue uploading cover photo lead generation form using php sdk experiencing issue facebook php sdk trying upload cover photo lead generation form despite following sdk documentation examples keep encountering error facebookgraphapifacebookphpsdkfacebookpage mural colyaran asked nov
164"reload a part of the wordpress page with jquery or similar to ajax [closed] hi i am a new programer i want to update part of my wordpress page content which is a shortcode from a php file without refreshing the whole page. but i don't know how to use hook and action in the ... phpjquerywordpress sara 9 asked nov 13, 2023 at 19:52","['php', 'jquery', 'wordpress']",en,reload part wordpress page query similar ajax closed hi new programmer want update part wordpress page content sortcode php file without refreshing whole page know use hook action phpjquerywordpress sara asked nov
165"why i18next's fallbacklng overrides changelanguage? i have a node.js app & i'm trying to support multi-language based on the url query string. i used i18next module. this is a snippet of my main index.ts ... import i18next from 'i18next'; import ... node.jstypescriptexpressi18next ahmed 525 asked sep 7, 2023 at 13:46","['node.js', 'typescript', 'express', 'i18next']",en,inexts fallbacklng overrides changelanguage nodejs app trying support multilanguage based url query string used inext module snippet main indexts import inext inext import nodejstypescriptexpressinext ahmed asked sep
166"progress bar when copying one large file in python? i want to use tqdm to display a progress bar when copying a single large file from one filepath to another. this is not the same as showing a progress bar when copying multiple small files. pythonfile-copyingtqdm david foster 8,045 asked sep 10, 2023 at 21:56","['python', 'file-copying', 'tqdm']",en,progress bar copying one large file python want use team display progress bar copying single large file one filepath another showing progress bar copying multiple small files pythonfilecopyingtqdm david foster asked sep
167"python package and conda environnement i have encountered a behavior relative to package versions in different conda environment that i don’t understand and seems illogical. there is probably something fundamental that i do not understand ... pythoncondaenvironment fred dujardin 293 asked sep 4, 2024 at 8:18","['python', 'conda', 'environment']",en,python package honda environment encountered behavior relative package versions different honda environment understand seems illogical probably something fundamental understand pythoncondaenvironment fred jardin asked sep
168"how to get one character at a time what the outcome should look like: g -- c c -- g t -- a t -- a c -- g t -- a t -- a a -- t c -- g c -- g c -- g g -- c t -- a what it actually looks like: gcttcttacccgtgccccac -- c ... cmmap goodoboi69 13 asked mar 1, 2024 at 21:27","['c', 'mmap']",en,get one character time outcome look like g c c g c g c g c g c g g c actually looks like gcttcttacccgtgccccac c map goodoboi asked mar
169"i am getting errors on ngmodels in angular enter image description here i am new to angular... when i implementing ngmodels i get some errors that property 'eunwrapwritablesignal' does not exist on type..... like in the picture please guys ... angularcomponentsngmodel sivabalan 1 asked feb 24, 2024 at 11:43","['angular', 'components', 'ngmodel']",en,getting errors models angular enter image description new angular implementing models get errors property eunwrapwritablesignal exist type like picture please guys angularcomponentsngmodel sivabalan asked feb
170"execute multiple steps in parallel in circleci i have a circleci job with the following structure. jobs: test: steps: - checkout - run #1 ...<<install dependencies>> - run #2 ...<<execute ... circleci nakaakist 358 asked feb 27, 2022 at 14:26",['circleci'],en,execute multiple steps parallel circle circle job following structure jobs test steps checkout run run execute circle nakaakist asked feb
171"react: sync with the localstorage have a react app. some specific component would be setting different data values with same key to localstorage over a time. i need to have few components subscribed to that item in the localstorage. ... javascriptreactjslocal-storagewebapi abhinandan khilari 1,077 asked jun 14, 2023 at 14:57","['javascript', 'reactjs', 'local-storage', 'webapi']",en,react sync localstorage react app specific component would setting different data values key localstorage time need components subscribed item localstorage javascriptreactjslocalstoragewebapi abhinandan hilary asked jun
172"from text datetime to date in postgresql [duplicate] i am to go from text column date which is stored like this: 1990-04-02t00:00:00.000 to a date in format 'yyyy-mm-dd' how do i do this is postgresql? sqlpostgresqlselect coderman 161 asked apr 23, 2024 at 15:18","['sql', 'postgresql', 'select']",en,text daytime date postgresql duplicate go text column date stored like date format yyyymmdd postgresql sqlpostgresqlselect alderman asked apr
173"how can i get the mask from contours to apply skeltonization enter image description herebelow is an image containing road contours. i want to apply skeletonization, but i'm getting poor results. so, i thought of first obtaining the mask from the contours and ... image-processingcomputer-visioncomputer-sciencemaskcontour rania saoud 1 asked may 4, 2024 at 8:38","['image-processing', 'computer-vision', 'computer-science', 'mask', 'contour']",en,get mask contours apply skeltonization enter image description herebelow image containing road contours want apply skeletonization getting poor results thought first obtaining mask contours imageprocessingcomputervisioncomputersciencemaskcontour mania asked may
174"laravel livewire wire:modle and wire:click showing 404 on cpanel but works fine on localhost laravel livewire works perfectly on localhost but when deploy to cpanel; shared hosting, wire:click and wire:model, not working, for example i have a live data search implemented with livewire, but ... phplaravelhttp-status-code-404laravel-livewire victor vibist tetteh 11 asked jul 13, 2024 at 20:01","['php', 'laravel', 'http-status-code-404', 'laravel-livewire']",en,travel likewise wiremodel wireclick showing panel works fine localhost travel likewise works perfectly localhost deploy panel shared hosting wireclick wiremodel working example live data search implemented likewise phplaravelhttpstatuscodetravellikewise victor visit better asked jul
175"check if two columns have a one-to-one relationship in r [duplicate] is there any existing r functionality to check if two columns have a one-to-one relationship (regardless of column type). example of expected output: a b c 0 'a' 'apple' 1 'b' 'banana'... r jrc 287 asked sep 28, 2022 at 13:40",['r'],en,check two columns onetoone relationship duplicate existing r functionality check two columns onetoone relationship regardless column type example expected output b c apple b banana jr asked sep
176"sourcetree keeps crashing after upgrade to 4.1.1 i upgraded the source to latest version 4.1.1 but it keeps crashing whenever i click any repo after that. how can i fix it? process: sourcetree [9208] path: /... atlassian-sourcetreemacos-big-sur phillip 91 asked jun 16, 2021 at 16:34","['atlassian-sourcetree', 'macos-big-sur']",en,sourcetree keeps crashing upgrade upgraded source latest version keeps crashing whenever click repo fix process sourcetree path atlassiansourcetreemacosbigsur phillip asked jun
177"stripe integration not working in testflight builds i’ve integrated stripe’s paymentsheet class into my code. payments work perfectly when i run the app using the debug scheme in xcode. however, the integration fails on testflight builds. in the ... iosarraysstripe-payments robby 93 asked yesterday","['ios', 'arrays', 'stripe-payments']",en,stripe integration working testflight builds integrated stripes paymentsheet class code payments work perfectly run app using debug scheme code however integration fails testflight builds iosarraysstripepayments lobby asked yesterday
178"node_modules file not created i was creating a project with the help of a video. i am writing the codes with visualstudiocode. the following step in the terminal worked properly and the packet.json file was created; npm init then ... reactjsnode.js nes 19 asked sep 2, 2024 at 11:52","['reactjs', 'node.js']",en,nodemodules file created creating project help video writing codes visualstudiocode following step terminal worked properly packetson file created num init reactjsnodejs nes asked sep
179"sagemaker sparkml_model deploy error: the primary container for production variant alltraffic did not pass the ping health check sagemaker using mleap-spark::0.17.0 emr- 5.24.0 my code snippet: from time import gmtime, strftime import time timestamp_prefix = strftime(""%y-%m-%d-%h-%m-%s"", gmtime()) import sagemaker from ... amazon-sagemaker sushantpatade 364 asked dec 24, 2023 at 8:40",['amazon-sagemaker'],en,pacemaker sparkedmodel deploy error primary container production variant alltraffic pass ping health check pacemaker using leapspark code snippet time import time strftime import time timestampprefix strftimeymdhms time import pacemaker amazonpacemaker sushantpatade asked dec
180"what is wrong with this promise.all code? [closed] i have a page made up of multiple forms. each form has it's own javascript file with a validate method like so. function validateform(){ return new promise((resolve, reject) => { ... javascriptes6-promise geoff swartz 6,015 asked yesterday","['javascript', 'es6-promise']",en,wrong promiseall code closed page made multiple forms form javascript file validate method like function validateform return new promiseresolve reject javascriptpromise geoff start asked yesterday
181"pair without replacement i have a dataframe of treatments and i want to pair these up with suitable controls. each control can only be assigned to one treatment. the treatments match with controls if the group is the same and ... pythonpandasmergeduplicates alig265 1 asked nov 22, 2023 at 20:54","['python', 'pandas', 'merge', 'duplicates']",en,pair without replacement dataframe treatments want pair suitable controls control assigned one treatment treatments match controls group pythonpandasmergeduplicates align asked nov
182"how to use getapplicationdocumentsdirectory() with flutter for web i'm a beginner in flutter, i want to use sqlite database using sqflite package in my flutter app, i'm running my flutter app on chrome because i have the emulator not working, i use ... flutter imane imane 179 asked nov 8, 2022 at 23:21",['flutter'],en,use getapplicationdocumentsdirectory clutter web beginner clutter want use site database using sqflite package clutter app running clutter app chrome emulator working use clutter image image asked nov
183"avalonialocator current does not exists linux avalonialocator.current is not a public property and in the docs that i read they all use it. so im trying to update an image if it is a folder or file but i read that you have to convert it yourself ... imageassetsavaloniauiavalonia crazy games 83 asked aug 3, 2023 at 7:34","['image', 'assets', 'avaloniaui', 'avalonia']",en,avalonialocator current exists linux avalonialocatorcurrent public property docs read use trying update image folder file read convert imageassetsavaloniauiavalonia crazy games asked aug
184"can a table have multiple primary keys? i am very confused right now, maybe you can help me to understand the problem better regarding the question that can a table have two primary keys if yes then how ? and if no, then why? mysqlsqlsql-serverdatabasesql-server-2008 pankaj kumar 685 asked dec 23, 2013 at 11:49","['mysql', 'sql', 'sql-server', 'database', 'sql-server-2008']",en,table multiple primary keys confused right maybe help understand problem better regarding question table two primary keys yes mysqlsqlsqlserverdatabasesqlserver lanka kumar asked dec
185"javascript async/await polling to get a status - function doesn't return the correct data context: asynchronous tasks management in django with celery and redis. i have a function that sends a post request in ajax. the server returns a task id. with the task id i launch another function ... javascriptdjangoasync-awaitfetchcelery redjam 534 asked aug 17, 2023 at 20:15","['javascript', 'django', 'async-await', 'fetch', 'celery']",en,javascript syncawait polling get status function return correct data context asynchronous tasks management tango every redir function sends post request ajax server returns task id task id launch another function javascriptdjangoasyncawaitfetchcelery redeem asked aug
186"gradle could not target platform: 'java se 11' using tool chain: 'jdk 8 (1.8)' i'm building ghidra according to the installation guide. everything goes fine until i get here. once i call $ gradle buildghidra i get the following error: > could not target platform: 'java se 11'... javagradleghidra orenishshalom 7,200 asked oct 1, 2020 at 10:29","['java', 'gradle', 'ghidra']",en,grade could target platform java se using tool chain jk building chira according installation guide everything goes fine get call grade buildghidra get following error could target platform java se javagradleghidra orenishshalom asked oct
187"swift: make int enum conform to plottable protocol in order to show a legend using swift charts i am trying to make my int enum conform to plottable in order to use a legend in my swift charts. i'm not sure if i've understood the way on how to implement it correctly. here is how my enum: enum ... swiftswiftuiswiftui-charts daniel 1,057 asked aug 19, 2022 at 11:43","['swift', 'swiftui', 'swiftui-charts']",en,swift make int num conform portable protocol order show legend using swift charts trying make int num conform portable order use legend swift charts sure understood way implement correctly num num swiftswiftuiswiftuicharts daniel asked aug
188"python typing deprecation the latest typing docs has a lot of deprecation notices like the following: class typing.deque(deque, mutablesequence[t]) a generic version of collections.deque. new in version 3.5.4. new in version ... pythonpython-3.xpython-typing abhijit sarkar 24.8k asked mar 21, 2021 at 23:46","['python', 'python-3.x', 'python-typing']",en,python typing depreciation latest typing docs lot depreciation notices like following class typingduedue mutablesequencet generic version collectionsdue new version new version pythonpythonpythontyping abhijit marker k asked mar
189"can't center a div with react and tailwindcss i can't seem to center a div the normal way with react and tailwind whatever i try i get this her is my code: ""use client""; import image from ""next/image""; import react from &... cssreactjsnext.jstailwind-css user21841027 asked sep 23, 2023 at 16:30","['css', 'reactjs', 'next.js', 'tailwind-css']",en,cannot center div react tailwindcss cannot seem center div normal way react tailwind whatever try get code use client import image nextimage import react cssreactjsnextjstailwindcss user asked sep
190"in game loop, how do i restart game properly using nested class or loop? i making a game in python3 using pygame, logic of my game happens in run loop. my question is how do i make game restart, without having use nested class and loop as in example below? i am afraid this ... pythonloopsclasspygamenested von 55 asked oct 13, 2022 at 18:41","['python', 'loops', 'class', 'pygame', 'nested']",en,game loop restart game properly using nested class loop making game python using game logic game happens run loop question make game restart without use nested class loop example afraid pythonloopsclasspygamenested von asked oct
191"stm8l mcu rtc calibration problem using rtc_smoothcalibconfig() stm8l151k4 mcu rtc external crystal works stably but returns error when i want to write calibration value. ""rtc_smoothcalibconfig(rtc_smoothcalibperiod_32sec, rtc_smoothcalibpluspulses_reset,50);&... stm32calibrationreal-time-clockstm8 habip 11 asked nov 24, 2023 at 21:50","['stm32', 'calibration', 'real-time-clock', 'stm8']",en,stml mcu utc calibration problem using utcsmoothcalibconfig stmlk mcu utc external crystal works stable returns error want write calibration value utcsmoothcalibconfigutcsmoothcalibperiodsec utcsmoothcalibpluspulsesreset stmcalibrationrealtimeclocks habit asked nov
192"where to store answers in quiz app database or session [closed] i'm building a quiz app. in app there will be question and answers.user does not need to login just should fill form (name,lastname etc). user will see questions in slides where he can get next page ... javascriptphpmysqllaravel-5eloquent ilyas azizzade 13 asked 6 hours ago","['javascript', 'php', 'mysql', 'laravel-5', 'eloquent']",en,store answers quiz app database session closed building quiz app app question answersuser need login fill form namelastname etc user see questions slides get next page javascriptphpmysqllaraveleloquent plays azizzade asked hours ago
193"recursive tree function traversal i have a tree that represents an excel function, where node contains name : function_name (for example sum);type : function_type (function or number); arguments : function_ arguments. the whole ... javascriptrecursiontreetreeview doxzi 3 asked dec 30, 2023 at 21:20","['javascript', 'recursion', 'tree', 'treeview']",en,recursive tree function reversal tree represents excel function node contains name functionname example sumtype functiontype function number arguments function arguments whole javascriptrecursiontreetreeview doi asked dec
194"""copy value"" when debuging in visual studio code with xdebug (php) it copy type of the variable when i'm debugging in visual studio code (linux), working in php, and right-click a variable, then click ""copy value"", it copy the type of the variable instead of content of the value, it ... phplinuxvisual-studio-codexdebug danarios 11 asked jul 20, 2023 at 19:00","['php', 'linux', 'visual-studio-code', 'xdebug']",en,copy value debuting visual studio code debug php copy type variable debugging visual studio code linux working php rightclick variable click copy value copy type variable instead content value phplinuxvisualstudiocodexdebug danarios asked jul
195"how to ensure updated data with pessimistic_write lock without using entitymanager.refresh? i’m having an issue with a hibernate query where i need to use a pessimistic_write lock. the lock works fine in concurrent transactions, but the information returned by the query is outdated. to ... javaoracle-databasehibernatejpaentitymanager bruno fonseca 31 asked aug 20, 2024 at 19:02","['java', 'oracle-database', 'hibernate', 'jpa', 'entitymanager']",en,ensure updated data pessimisticwrite lock without using entitymanagerrefresh issue liberate query need use pessimisticwrite lock lock works fine concurrent transactions information returned query outdated javaoracledatabasehibernatejpaentitymanager bruno fonseca asked aug
196"ansible vault passwords exposed in plain text during execution i am actually using ansible to create user, with passwords stored in an ansible vault. however, i've encountered an issue where the passwords, despite being in the ansible vault, are displayed in ... ansiblepassword-hashansible-vault mrbibi38 38 asked jun 19, 2023 at 18:37","['ansible', 'password-hash', 'ansible-vault']",en,visible vault passwords exposed plain text execution actually using visible create user passwords stored visible vault however encountered issue passwords despite visible vault displayed ansiblepasswordhashansiblevault mrbibi asked jun
197"reborrow &t from &mut t [duplicate] let mut a = string::from(""abc""); let b = &mut a; let c = &*b; println!(""{}"", b); println!(""{}"", c); the mutable borrow (&mut t) is used concurrently with the ... rust clon 11 asked mar 8, 2024 at 15:39",['rust'],en,borrow duplicate let stringfromabc let b let c b print b print c notable borrow used concurrently rust lon asked mar
198"react-native: realm. userprovider fallback component not rendering when user is not logged in im working on a react-native expo app and have installed realm to implement mongo-db login. my code is: app.tsx: import { statusbar } from 'expo-status-bar'; import { text, view } from 'react-native'; ... react-nativeexporealm scarface764 33 asked jan 6, 2024 at 5:21","['react-native', 'expo', 'realm']",en,reactnative realm userprovider fullback component rendering user logged working reactnative expo app installed realm implement monodb login code apptax import statusbar expostatusbar import text view reactnative reactnativeexporealm surface asked jan
199"maui can't load images from android device i implemented the file picker as described here: learn.microsoft.com/... when i open the android explorer, all files (jpg + png) are greyed-out / not accessible. the important parts of my app you'll ... mauifilepicker frank mehlhop 2,280 asked oct 24, 2023 at 14:07","['maui', 'filepicker']",en,mai cannot load images android device implemented file picked described learnmicrosoftcom open android explorer files jpg png greedout accessible important parts app mauifilepicker frank mehlhop asked oct
200"can i generate all possible integer sequences of a particular form using sagemath? let $(5,r_1,r_2,r_3,0)$ be an integer sequence. i want to generate all possible sequences of this form subject to the following two constraints: (ii) $r_i$'s are distinct; (i) $|r_{i+1}-r_i|5$ for ... sage shyamalsayak 101 asked apr 30, 2024 at 3:43",['sage'],en,generate possible integer sequences particular form using cagematch let rrr integer sequence want generate possible sequences form subject following two constraints ii ris distinct riri sage shyamalsayak asked apr
201"qt.qpa.plugin: could not load the qt platform plugin ""windows"" in """" even though it was found i`m desperating since days, since i tried anything i found on the web since nearly 1 week now. i want to use the qtcreator 6.2.3 for making gui designs in python language, so i use the python-project ... pythonqtpyqtpyqt5qt-creator luca graebenteich 11 asked mar 8, 2022 at 17:07","['python', 'qt', 'pyqt', 'pyqt5', 'qt-creator']",en,qtpaplugin could load qt platform plugin windows even though found im desperation since days since tried anything found web since nearly week want use creator making gui designs python language use pythonproject pythonqtpyqtpyqtqtcreator luca graebenteich asked mar
202"mysql subtracting values between rows where the subtracted number is displayed along with the rows from which it is subtracted i have a table like: concatenated_dates mat_emp rest ex 2018/2019 ao-26 27.5 ex2019/2020 ao-26 30 ex2020/2021 ao-26 30 ex2021/2022 ao-26 30 ex2022/2023 ao-26 30 i want code that would subtract the ... mysql djallel merzoug 1 asked mar 28, 2024 at 12:17",['mysql'],en,subtraction values rows subtracted number displayed along rows subtracted table like concatenateddates matemp rest ex ao ex ao ex ao ex ao ex ao want code would subtract djallel merzoug asked mar
203"aws cloudwatch filter @logstream in logs insights is there a way to filter in a widget only the @logstream s which do not contain a specific log message? i tried to use a log table with some filters as presented in: https://docs.aws.amazon.com/... amazon-web-servicesamazon-cloudwatchaws-cloudwatch-log-insights keb 31 asked apr 8, 2021 at 9:16","['amazon-web-services', 'amazon-cloudwatch', 'aws-cloudwatch-log-insights']",en,aws cloudwatch filter logstream logs insights way filter widget logstream contain specific log message tried use log table filters presented amazonwebservicesamazoncloudwatchawscloudwatchloginsights web asked apr
204"discordapierror[50035]: invalid form body (discord.js v14) i'm trying to make a ticket system at discord.js v14 (the new version). the config values are correct and i have checked this by console.log them. i have an embed already with custom.id = ""open-... javascriptnode.jsdiscord.jsbotsticket-system red.1111 35 asked mar 23, 2023 at 7:57","['javascript', 'node.js', 'discord.js', 'bots', 'ticket-system']",en,discordapierror invalid form body discordjs v trying make ticket system discordjs v new version config values correct checked consolelog embed already customid open javascriptnodediscordjsbotsticketsystem red asked mar
205"implementing a matlab reader using winsock2 and dll library i am trying to interface matlab with a c code that i used to read data through udp. i am using the winsock2 library, and compiling the c code into a dll file for it to be loaded into matlab. my c code ... matlabdlludpwinsock2loadlibrary tamim akhtar 11 asked may 17, 2024 at 15:05","['matlab', 'dll', 'udp', 'winsock2', 'loadlibrary']",en,implementing atlas reader using winsock library trying interface atlas c code used read data using winsock library compiling c code file loaded atlas c code matlabdlludpwinsockloadlibrary tamil altar asked may
206"how to pass a long string to a starknet contract in python for example, in the following transaction, https://starkscan.co/tx/0x012829d678c9b5bff701a6f2fed31744e14e736a209f61522fbc0bb65be98983, a long string data:,{\""p\"":\""stark-20\"",\&... pythonstarknet unix55 151 asked dec 20, 2023 at 11:22","['python', 'starknet']",en,pass long string starlet contract python example following transaction long string datapstark pythonstarknet unix asked dec
207"iframe handling issue with wait_until and .html methods watir: 7.0.0 selenium-webdriver: 4.0.0 ruby: 3.0.6 os: macos version 14.4 (23e214) latest firefox and geckodriver require 'watir' selenium::webdriver.logger.level = :info class testffissuewatir def ... rubyiframewatir santosh adhikari 21 asked mar 20, 2024 at 14:18","['ruby', 'iframe', 'watir']",en,iframe handling issue waituntil html methods water seleniumwebdriver ruby os marcos version e latest firefox geckodriver require water seleniumwebdriverlongerlevel info class testffissuewatir def rubyiframewatir santos adhikari asked mar
208"can't connect to public ip on port 80 with aws ec2 i've been trying for nearly 2 days now to deploy my node.js application to amazon aws on an ec2 instance and i can't for the life of me figure out why my application won't show up on the browser at &... node.jsamazon-web-servicesamazon-ec2 unkwndev 101 asked sep 28, 2023 at 14:06","['node.js', 'amazon-web-services', 'amazon-ec2']",en,cannot connect public ip port aws ec trying nearly days deploy nodejs application amazon aws ec instance cannot life figure application show browser nodeamazonwebservicesamazonec unkwndev asked sep
209"custom event listener - p5.js scenemanager i am trying to use scene manager in my p5.js application. however, this event is no longer working when i added it to the ""gamescene"". these lines are on a global level: function setup() { ... javascriptp5.js hadj ahmed 31 asked feb 28, 2024 at 15:34","['javascript', 'p5.js']",en,custom event listener pjs scenemanager trying use scene manager pjs application however event longer working added gamescene lines global level function setup javascriptjs ahmed asked feb
210"how to search specific text in 104gb file with only one line? i just finished calculating 111 billion digits of the pi number using y-cruncher, and there 104gb file. i ran into a problem. i want to play around, try to search there for name, values, titles and so ... linuxsearchgrep sdfsdf 21 asked oct 8, 2023 at 8:46","['linux', 'search', 'grep']",en,search specific text gb file one line finished calculating billion digits pi number using ylauncher gb file ran problem want play around try search name values titles linuxsearchgrep sdfsdf asked oct
211"liquid syntax error: expected end_of_string but found string. why didn't this work? i'm creating a table that goes into the description of a product page with shopify liquid. i wrote the table with hardcoded values successfully. then i tried to get the values from a metafield that is ... shopifyliquid orotomo 1 asked mar 6, 2023 at 17:05","['shopify', 'liquid']",en,liquid syntax error expected endofstring found string work creating table goes description product page spotify liquid wrote table hardcore values successfully tried get values metafield shopifyliquid orotomo asked mar
212"mapping attributes to several statuses with date of each status in my data warehouse fact table i hope you are well. i have this problem and i am a beginner in datawerehousing. i hope to find a solution to it. i have an oltp database from the glpi system. we are only interested in ticket ... data-warehousefact-table anfel andel 1 asked may 13, 2024 at 13:59","['data-warehouse', 'fact-table']",en,mapping attributes several statuses date status data warehouse fact table hope well problem beginner datawerehousing hope find solution lt database gli system interested ticket datawarehousefacttable angel angel asked may
213"can't write to lockfile while frozen ruby on rails hello i'm trying to run the following commands to prep my rails app for production: bundle lock --add-platform ruby bundle lock --add-platform x86_64-linux then i get this error: cannot write a ... ruby-on-railsrubyrubygemslockfile cjg 558 asked oct 4, 2021 at 19:55","['ruby-on-rails', 'ruby', 'rubygems', 'lockfile']",en,cannot write logofile frozen ruby rails hello trying run following commands prep rails app production bundle lock addplatform ruby bundle lock addplatform xlinux get error cannot write rubyonrailsrubyrubygemslockfile cg asked oct
214"white 1-px border remaining in trimmed gnuplot png export i am exporting matrix-shaped data as an image via gnuplot. however, after having made 0-sized margins and removed any border/tics, the export of nxm data results in a (n+1)x(m+1) image... file test.... gnuplot joce 2,352 asked apr 30, 2024 at 14:01",['gnuplot'],en,white px border remaining trimmed gnuplot png export exporting matrixshaped data image via gnuplot however made sized margins removed bordertico export num data results nxm image file test gnuplot joke asked apr
215"how can i use the 'shallow: true' option with 'router.replace' in next.js 13? does anyone has a solution for using shallow: true, when using router.replace? im working with next 13, in this version i have not found anything that works like shallow. i want a way to do the same ... javascriptreactjsnext.jsnext.js13 peter castillo 11 asked may 25, 2023 at 21:49","['javascript', 'reactjs', 'next.js', 'next.js13']",en,use shallow true option routerreplace nextjs anyone solution using shallow true using routerreplace working next version found anything works like shallow want way javascriptreactjsnextnextjs peter castillo asked may
216"confusion around lark priorities i'm using lark, an excellent python parsing library. it provides an earley and lalr(1) parser and is defined through a custom ebnf format. (ebnf stands for extended backus–naur form). lowercase ... pythonregexparsingebnflark vicvic 53 asked jan 30, 2024 at 16:18","['python', 'regex', 'parsing', 'ebnf', 'lark']",en,confusion around lark priorities using lark excellent python parsing library provides early lar parser defined custom ebf format ebf stands extended backsnar form lowercase pythonregexparsingebnflark victim asked jan
217"how to find the shortest paths of a weighted direct graph represented by an incidence matrix using dijkstra's algorithm? on the internet, unfortunately, i only found dijkstra’s algorithm for the adjacency matrix, but nowhere is there dijkstra’s algorithm for the incidence matrix. my incidence matrix (the first row of ... c++algorithmgraphgraph-theory denis bredun 31 asked dec 5, 2023 at 16:41","['c++', 'algorithm', 'graph', 'graph-theory']",en,find shortest paths weighted direct graph represented incidence matrix using dijkstras algorithm internet unfortunately found dijkstras algorithm adjacent matrix nowhere dijkstras algorithm incidence matrix incidence matrix first row calgorithmgraphgraphtheory denis begun asked dec
218"how can i remove an table's tr with javascript? first of all, super beginner here. i'm trying to do a to do list. the add part works fine, it looks like this:
let salvar = document.getelementbyid(""salvar"") let remove = document.getelementbyid(""... javascripthtml josé carlos 774 asked jan 13, 2022 at 11:52","['javascript', 'html']",en,remove tables tr javascript first super beginner trying list add part works fine looks like let silver documentgetelementbyidsilver let remove documentgetelementbyid javascripthtml jose carlos asked jan
219"does php allow named parameters so that optional arguments can be omitted from function calls? is it possible in php to specify a named optional parameter when calling a function/method, skipping the ones you don't want to specify (like in python)? something like: function foo($a, $b = '', $c = ... phpdefault-valueoptional-parametersnamed-parametersphp-8 stefano borini 144k asked aug 27, 2009 at 18:26","['php', 'default-value', 'optional-parameters', 'named-parameters', 'php-8']",en,php allow named parameters optional arguments omitted function calls possible php specify named optional parameter calling functionmethod skipping ones want specify like python something like function fooa b c phpdefaultvalueoptionalparametersnamedparametersphp stefan boring k asked aug
220"how to display exactly 7 bars at once in swiftui chart? i'm working with swiftui's chart and i want to display exactly 7 bars at once on the screen. currently, with the following code snippet, i'm only able to see 3 bars at a time on my iphone 11, and i ... swiftswiftuibar-charthorizontal-scrolling leem 3 asked aug 18, 2024 at 20:54","['swift', 'swiftui', 'bar-chart', 'horizontal-scrolling']",en,display exactly bars swift chart working swifts chart want display exactly bars screen currently following code snippet able see bars time iphone swiftswiftuibarcharthorizontalscrolling seem asked aug
221"how do i troubleshoot decrypting this openpgp.js message? i have a string message called customerpublickey which i encrypted with openpgp.js: const { customerpublickey} = await openpgp.generatekey({ type: 'rsa', passphrase: contract.... openpgp.js boris k 3,590 asked aug 2, 2023 at 21:10",['openpgp.js'],en,troubleshoot decrypting openpgpjs message string message called customerpublickey encrypted openpgpjs const customerpublickey await openpgpgeneratekey type rsa paraphrase contract openpgpjs boris k asked aug
222"are there any issues with directly accessing redisstore with express-session? i am using express with socket.io. i need both the express requests and socket.io to use the latest version of the express-session, for consistency. the way i had to do it previously was with: req.... javascriptexpressredissocket.io bobthefishmonger 53 asked jun 16, 2024 at 15:31","['javascript', 'express', 'redis', 'socket.io']",en,issues directly accessing redisstore expresssession using express socketio need express requests socketio use latest version expresssession consistency way previously req javascriptexpressredissocketio bobthefishmonger asked jun
223"vaadin 24 dynamic css with flow is there a way to apply dynamic css with selectors via vaadin flow? obviously, you can set css pretty easily in most circumstances. my specific problem is that i have dynamic background colors for ... javacssvaadinvaadin-flowvaadin24 curtis snowden 503 asked apr 18 at 19:09","['java', 'css', 'vaadin', 'vaadin-flow', 'vaadin24']",en,vain dynamic css flow way apply dynamic css selectors via vain flow obviously set css pretty easily circumstances specific problem dynamic background colors javacssvaadinvaadinflowvaadin curtis snowden asked apr
224"how can i get the parents of a merge commit in git? some git commands take the parent as a revision; others (such as git revert), as a parent number. how can i get the parents for both cases? i don’t want to use the graphical log command as that often ... gitmerge casebash 119k asked jan 30, 2012 at 4:25","['git', 'merge']",en,get parents merge commit git git commands take parent revision others git revert parent number get parents cases want use graphical log command often histmerge casebash k asked jan
225"my nextjs timer is not stopping and becomes negative. how can i fix this? below is the code for my timer. i get the 'createdat' prop from my database, and everything works perfectly. however, when reaching 0, the timer doesn't stop and instead keeps going. i've tried adding ... javascriptreactjsdatenext.jstimer ethereumboy 141 asked oct 31, 2022 at 19:06","['javascript', 'reactjs', 'date', 'next.js', 'timer']",en,next timer stopping becomes negative fix code timer get created prop database everything works perfectly however reaching timer stop instead keeps going tried adding javascriptreactjsdatenexttimer ethereumboy asked oct
226"springboot 3 webflux r2dbc mysql timezone issue i'm using r2dbc with mysql to connect db for spring boot webflux service. my application.yml is below: spring: r2dbc: url: r2dbc:mysql://localhost:3306/testdb?usejdbccomplianttimezoneshift=true&... spring-webfluxspring-data-r2dbcr2dbc-mysql shakthi 864 asked apr 15, 2023 at 7:19","['spring-webflux', 'spring-data-r2dbc', 'r2dbc-mysql']",en,springboot reflux rdbc timezone issue using rdbc connect db spring boot reflux service applicationml spring rdbc url rdbcmyselflocalhosttestusejdbccomplianttimezoneshifttrue springwebfluxspringdatardbcdbcmyself shakthi asked apr
227"axios error handling when executing a request on the server side using next.js 13 i just recently started working with next.js 13 and using the app directory. i ran into a problem using axios and interceptors. description: i can't find information on how to handle an error, for ... javascriptnext.jsaxiosreact-server-components christian tchaikovsky 192 asked oct 19, 2023 at 7:21","['javascript', 'next.js', 'axios', 'react-server-components']",en,axis error handling executing request server side using nextjs recently started working nextjs using app directory ran problem using axis interceptor description cannot find information handle error javascriptnextjsaxiosreactservercomponents christian tchaikovsky asked oct
228"can i use a variable created for a component with an on click event? i have 56 panels, and i created a loop running through them, selecting a random panel. after a random panel is selected, i use findcomponent() with the name of the random panel, and assign a variable ... delphi low von dyk 11 asked oct 26, 2022 at 17:37",['delphi'],en,use variable created component click event panels created loop running selecting random panel random panel selected use findcomponent name random panel assign variable delhi low von dyk asked oct
229"missingschemaerror: schema hasn't been registered for model ""officer"" unable to populate() the hasofficer field in the locations collections. i have been trying to figure out this for the past one hour. officermodel.ts import mongoose from ""mongoose""; const ... node.jsmongodbmongoosenon-relational-database prajwal 11 asked jun 15, 2024 at 19:19","['node.js', 'mongodb', 'mongoose', 'non-relational-database']",en,missingschemaerror schema registered model officer unable populate hasofficer field locations collections trying figure past one hour officermodelts import mongoose mongoose const nodejsmongodbmongoosenonrelationaldatabase prajwal asked jun
230why is zig c++ binary so huge? if i do: g++ ./main.cpp -o main.exe i get a size of 16.4kb. but if i do: zig c++ ./main.cpp -o main.exe the result is 7.5mb. why!!! and how can i make it smaller? oh in case it matters (it shouldn't)... compilationzig zebrafish 15.1k asked 8 hours ago,"['compilation', 'zig']",en,zig c binary huge g maincpp mainexe get size kb zig c maincpp mainexe result mb make smaller oh case matters compilationzig zebrafish k asked hours ago
231"make dataframe into wide format and group columns by pairing [closed] i have a dataframe that can be simplified to this: example <- data.frame( pid = c(1091, 1358, 1087, 2358, 2087, 2091), value = c('1','2', '1,4,6', '2', '2', '1') ) i want to do a few things ... rdplyr jo_ 753 asked feb 21, 2024 at 15:11","['r', 'dplyr']",en,make dataframe wide format group columns pairing closed dataframe simplified example dataframe pid c value c want things reply jo asked feb
232"common attribute for multiple schema files in bpmn (xml) can someone help me with a way to add a common attribute to multiple flow schemas? i have different schema files for different task types which are responsible for attributes of those tasks. i want to ... javascriptxmlbpmnbpmn.iobpmn-js shaan srivastava 39 asked feb 9, 2024 at 5:47","['javascript', 'xml', 'bpmn', 'bpmn.io', 'bpmn-js']",en,common attribute multiple schema files bpm xml someone help way add common attribute multiple flow schemes different schema files different task types responsible attributes tasks want javascriptxmlbpmnbpmniobpmnjs srivastava asked feb
233"asset symbol generation in swift package i have a swift package in my swiftui project that includes styles for ui components. also, this package includes a resource folder that contains assets that can be used in styling. i can get an image ... swiftswiftuixcode15 dogan altinbas 461 asked jul 17, 2023 at 13:36","['swift', 'swiftui', 'xcode15']",en,asset symbol generation swift package swift package swift project includes styles ui components also package includes resource folder contains assets used styling get image swiftswiftuixcode logan altinbas asked jul
234"why is fs.createwritestream throwing a ""error: enoent: no such file or directory"" error? here is the code: const dest = fs.createwritestream('./src/pages/downloads/' + filename + '.' + type) await drive.files.export( {fileid: fileid, mimetype: newtype}, {responsetype: 'stream'}, ... javascriptnode.jsfileasynchronousnode.js-fs matt.g 201 asked feb 24, 2021 at 1:20","['javascript', 'node.js', 'file', 'asynchronous', 'node.js-fs']",en,fscreatewritestream throwing error event file directory error code const dest fscreatewritestreamsrcpagesdownloads filename type await drivefilesexport filed filed nametype viewtype responsetype stream javascriptnodejsfileasynchronousnodejsfs mattg asked feb
235"google cloud: cannot create static ip i am tryign to create a static ip address using the google cloud console terminal: gcloud compute addresses create helloweb-ip --region us-central1 it returns with: created [https://www.googleapis.... google-cloud-platformgcloud kirk sefchik 812 asked dec 27, 2023 at 9:13","['google-cloud-platform', 'gcloud']",en,google cloud cannot create static ip trying create static ip address using google cloud console terminal cloud compute addresses create hellowebip region uscentral returns created googlecloudplatformgcloud kirk sefchik asked dec
236"how to show a previously signed document to the next signer? i have the following signing order for an envelope (composite template): template a (signer1) -> template b (signer 2) what i'm trying to accomplish is signer 2 to be able see tamplate a with ... docusignapi e_preto 1 asked jan 12, 2024 at 18:59",['docusignapi'],en,show previously signed document next signer following signing order envelope composite template template signer template b signer trying accomplish signer able see template docusignapi eproto asked jan
237"clerk's <googleonetap/> isn't showing up? checked all the credentials like client_id & secret_id from google console, still it doesn't appear. the error that i got on console: client:73 [gsi_logger]: the given origin is not allowed for ... google-signinclerkgoogle-one-tapnextjs-15 shivraj roy 1 asked 3 hours ago","['google-signin', 'clerk', 'google-one-tap', 'nextjs-15']",en,clerks showing checked credentials like clientid secretid google console still appear error got console client silonger given origin allowed googlesigninclerkgoogleonetapnextjs shivraj roy asked hours ago
238"what is the difference between gridapi and gridoptions in aggrid v28 i'm asking this because i'm confused between the two. is gridapi a part of 'gridoptions' or is it the reverse. i'm carefully going through the documentation. i was assuming that ""grid api"" ... angularag-gridag-grid-angular tanzeel 5,058 asked nov 13, 2022 at 10:45","['angular', 'ag-grid', 'ag-grid-angular']",en,difference gridapi gridoptions grid v asking confused two gridapi part gridoptions reverse carefully going documentation assuming grid api angulargridgridangular tanzeel asked nov
239"how can i convert an if/else statement written in spyder python to databricks pyspark? i am looking to convert a python if/else statement written in spyder to azure databricks , i am still rather new to pyspark and not sure how to approach this ... ideas on how to approach this would ... pysparkapache-spark-sqlazure-databricks dan a 27 asked oct 25, 2023 at 22:03","['pyspark', 'apache-spark-sql', 'azure-databricks']",en,convert ifelse statement written spider python databricks spark looking convert python ifelse statement written spider azure databricks still rather new spark sure approach ideas approach would pysparkapachesparksqlazuredatabricks dan asked oct
240"next js/ sass loop i was developing a portfolio for a friends earlier today and all was fine. all of a sudden i get a message saying i don't have sass installed, even though i installed in and had been running on port ... javascriptreactjsexpressvisual-studio-codesass coachmikemarshall 11 asked apr 13, 2023 at 18:32","['javascript', 'reactjs', 'express', 'visual-studio-code', 'sass']",en,next js says loop developing portfolio friends earlier today fine sudden get message saying says installed even though installed running port javascriptreactjsexpressvisualstudiocodesass coachmikemarshall asked apr
241one raw of data is missing in data table when displaying the data [closed] i have set of records from the table which im trying to display it in datatable to user. but when i display the result from sql one specifi record of data is missing in datatable. before displaying in ... datatablecodeigniter-3 rizkan 1 asked yesterday,"['datatable', 'codeigniter-3']",en,one raw data missing data table displaying data closed set records table trying display debatable user display result sql one specific record data missing debatable displaying datatablecodeigniter rian asked yesterday
242"remnant characters when tab completing with zsh i'm using oh-my-zsh in arch linux with the robbyrussell theme loaded. when i try to tab complete i end up with remnant characters appended to the prompt. if i delete the auto-completed characters, the ... zshoh-my-zsh concordus applications 987 asked oct 10, 2013 at 20:11","['zsh', 'oh-my-zsh']",en,remnant characters tab completing zh using ohmyzh arch linux robbyrussell theme loaded try tab complete end remnant characters appended prompt delete autocompleted characters showmyzh concord applications asked oct
243"chrome extension: fetching the value of a dom element i'm building my first chrome extension and my goal is to fetch the value of a dom element from the extension popup by the click of a button. i'm basically following the exact documentation on how to ... javascriptgoogle-chrome-extension max vallee 476 asked feb 2, 2023 at 2:50","['javascript', 'google-chrome-extension']",en,chrome extension etching value dom element building first chrome extension goal fetch value dom element extension popup click button basically following exact documentation javascriptgooglechromeextension max valley asked feb
244"how can i use, in r with the caret package, the f2 score as a metric for the feature selection using genetic algorithm and random forest as a model? i am trying to use the genetic algorithm of the caret r package to do feature selection and use at the end a random forest (ranger) to do the predictions. instead of using accuracy as a metric i would ... metricsgenetic-algorithmr-caretfeature-selection miranda 1 asked sep 3, 2024 at 23:03","['metrics', 'genetic-algorithm', 'r-caret', 'feature-selection']",en,use r care package f score metric feature selection using genetic algorithm random forest model trying use genetic algorithm care r package feature selection use end random forest ranger predictions instead using accuracy metric would metricsgeneticalgorithmcaretfeatureselection miranda asked sep
245"sequence type syntax and union types i'm struggling to find a good explanantion of what is and isnt possible for variable types in xslt 3+ (which i believe uses xpath sequence type syntax) if i have a template/function/variable that is ... xpathxslt-3.0 mrd at kookerellaltd 2,817 asked nov 15, 2023 at 8:55","['xpath', 'xslt-3.0']",en,sequence type syntax union types struggling find good explanation possible variable types xsl believe uses path sequence type syntax templatefunctionvariable xpathxslt rd kookerellaltd asked nov
246"fit api issue with reading calories and distance i am trying to read steps, distance and calories from google fit api, used below data request for steps val datasource = datasource.builder() .setapppackagename(""com.google.android.... javaandroidkotlinandroid-developer-apigoogle-fit-api surendra naidu karna 49 asked sep 19, 2024 at 10:01","['java', 'android', 'kotlin', 'android-developer-api', 'google-fit-api']",en,fit api issue reading calories distance trying read steps distance calories google fit api used data request steps val datasource datasourcebuilder setapppackagenamecomgoogleandroid javaandroidkotlinandroiddeveloperapigooglefitapi narendra nadu karla asked sep
247"missing character 'ہ' in urdu fonts when generating pdf using mpdf in php i am facing a unique challenge with the mpdf library in php when generating pdfs containing urdu text. the specific character causing issues is 'ہ' (heh), which appears to be either missing or not ... phpmpdfphp-8.2urdu muhammad yahya imran 93 asked jan 10, 2024 at 7:38","['php', 'mpdf', 'php-8.2', 'urdu']",en,missing character h urdu fonts generating pdf using pdf php facing unique challenge pdf library php generating pdfs containing urdu text specific character causing issues h heh appears either missing phpmpdfphpurdu muhammad yahoo iran asked jan
248"how to un-bin previously binned length data for a scatter plot i have pre-binned length data and i am trying to create a scatter/jitter plot with date on the x axis and length on the y axis. here is some example data: df<- as.data.frame(cbind(c(20:30), c(0,0,2,... rbinning connor 13 asked jan 4, 2024 at 0:32","['r', 'binning']",en,unbin previously banned length data scatter plot prebanned length data trying create scatterbitter plot date x axis length axis example data df asdataframebindc c winning connor asked jan
249"printing variable to console showing unexpected behavior the following piece of code was an attempt to print the largest sum out of all the subarrays of the given arraylist c, provided that the sum is not greater than the value given to a variable, b. ... javaconsolevariable-assignment davecodes_029 41 asked feb 15, 2024 at 5:07","['java', 'console', 'variable-assignment']",en,printing variable console showing unexpected behavior following piece code attempt print largest sum subarrays given arraylist c provided sum greater value given variable b javaconsolevariableassignment davecodes asked feb
250"using vbs to order all open windows in outlook after sleep mode in outlook, i have many windows open simultaneously. the inbox and calendar followed by 10-15 emails with ongoing cases. when the pc has been in sleep mode and wakes up again, it has switched the ... vbaoutlook allan bertelsen 223 asked apr 5, 2024 at 11:30","['vba', 'outlook']",en,using vs order open windows outlook sleep mode outlook many windows open simultaneously index calendar followed emails ongoing cases pc sleep mode wakes switched vbaoutlook allan bertelsen asked apr
251"change shell script to replace numbers in a file name with complementary sequence i have some 160 files, with continuous numbering within the file names, like abc_1_def.ext to uvw_162_yxz.ext. the numbers were generated in time sequence, unfortunately with the most recent data ... bashshellfile udippel 145 asked aug 30, 2023 at 9:34","['bash', 'shell', 'file']",en,change script replace numbers file name complementary sequence files continuous numbering within file names like abcdefext uwxzext numbers generated time sequence unfortunately recent data bashshellfile dipped asked aug
252"how to remove or end live activity from lock screen using push notification when app is in kill mode in ios [closed] ""event: update"" works perfectly fine. ""event: end"" not working nothing happens, only state data modified, live activity popup not removed from lock screen. { ""aps"": { &... iosswiftswiftui dhruvin thumar 210 asked mar 27, 2023 at 13:39","['ios', 'swift', 'swiftui']",en,remove end live activity lock screen using push notification app kill mode ios closed event update works perfectly fine event end working nothing happens state data modified live activity popup removed lock screen aps iosswiftswiftui dhruvin thumb asked mar
253"deploy asp.net core to azure vm - dotnet: command not found i have a vm set up in microsoft azure. i'm deploying an asp.net core app via github actions to the azure vm. every step in the deploy.yml file completes successfully, except the final step which ... asp.net-coregithub-actions goober 13.5k asked feb 24, 2024 at 17:00","['asp.net-core', 'github-actions']",en,deploy aspnet core azure vm done command found vm set microsoft azure deploying aspnet core app via github actions azure vm every step deployml file completes successfully except final step aspnetcoregithubactions footer k asked feb
254"command ""python setup.py egg_info"" failed with error code 1 in /tmp/pip-build-s6497k/setuptools/ i want install obfsproxy using pip at centos7 command: pip install --upgrade obfsproxy output: [root@ip231 ~]# pip install --upgrade obfsproxy collecting obfsproxy using cached https://files.... pythonpipcentos7 user180460 1 asked mar 14, 2023 at 6:16","['python', 'pip', 'centos7']",en,command python setuppy egginfo failed error code tmppipbuildsksetuptools want install obfsproxy using pip cents command pip install upgrade obfsproxy output rootip pip install upgrade obfsproxy collecting obfsproxy using cached pythonpipcentos user asked mar
255"bidirectional infinite pageview in swiftui i'm trying to make a bidirectional tabview (with .tabviewstyle(pagetabviewstyle(indexdisplaymode: .never))) whose datasource will change over time. below is the code that describes what is expected in ... iosswiftswiftuitabviewpageviews asio otus 121 asked dec 26, 2020 at 14:56","['ios', 'swift', 'swiftui', 'tabview', 'pageviews']",en,directional infinite pageview swift trying make directional tabview tabviewstylepagetabviewstyleindexdisplaymode never whose datasource change time code describes expected iosswiftswiftuitabviewpageviews asia ots asked dec
256"vscode complains in launch.json about ""configured debug type 'cppvsdbg' is installed but not supported in this environment."" i'm trying to run a c program in vscode. i am working to get a valid launch.json file, but it's complaining about the ""type"": ""cppvsdbg"" line, saying that the ""configured ... visual-studio-codevscode-debuggerlaunch taylor brown 381 asked sep 18, 2022 at 17:10","['visual-studio-code', 'vscode-debugger', 'launch']",en,uscode complains launchson configured debug type cppvsdbg installed supported environment trying run c program uscode working get valid launchson file complaining type cppvsdbg line saying configured visualstudiocodevscodedebuggerlaunch taylor brown asked sep
257"unique melt and pivot crosstab format with a groupby using pandas i have a dataset where i would like for some values to become column headers, as well as a crosstab format. data year qtr id type growth re nondd_re se_re or 2024 2024q1 ny aa ... pythonpandasnumpy lynn 4,418 asked feb 1, 2024 at 0:15","['python', 'pandas', 'numpy']",en,unique melt pivot rosstat format group using panda dataset would like values become column headers well rosstat format data year qtr id type growth nonre sere q ny aa pythonpandasnumpy lynn asked feb
258"angular, component to make a dynamic list with several fields inside the same form? i want to make a form to create invoices. and the users should be able to add and delete lines anyone know a good component or libary i can use to do this in angular? i tried to search but dosnt seem ... htmlangularformscomponents torbenrudgaard 2,581 asked jan 27, 2024 at 19:18","['html', 'angular', 'forms', 'components']",en,angular component make dynamic list several fields inside form want make form create voices users able add delete lines anyone know good component library use angular tried search seem htmlangularformscomponents torbenrudgaard asked jan
259"ajax call with separate woocommerce php function i am trying to build a custom page where user fills his product criteria by clicking on/off switch buttons and then when user clicks a ""submit"" button, the desired product will be visible ... phpjqueryajaxwordpresswoocommerce newbie 43 asked apr 25, 2024 at 11:03","['php', 'jquery', 'ajax', 'wordpress', 'woocommerce']",en,ajax call separate woocommerce php function trying build custom page user fills product criteria clicking onoff switch buttons user clicks submit button desired product visible phpjqueryajaxwordpresswoocommerce newbie asked apr
260"is there an option on typesense to allow unlimited documents? i recently moved from meilisearch to typesense on my laravel app working with scout. i've done all my configuration of models and search queries. i was using a local instance of typesense which ... laravelfull-text-searchlaravel-scouttypesense antoine kurka 322 asked jul 9, 2024 at 16:17","['laravel', 'full-text-search', 'laravel-scout', 'typesense']",en,option typesense allow unlimited documents recently moved meilisearch typesense travel app working scout done configuration models search queries using local instance typesense laravelfulltextsearchlaravelscouttypesense antoine kyrka asked jul
261"hiding ^m in emacs sometimes i need to read log files that have ^m (control-m) in the line endings. i can do a global replace to get rid of them, but then something more is logged to the log file and, of course, they ... emacsline-breakscarriage-returnline-endingseol russell asked apr 8, 2009 at 16:20","['emacs', 'line-breaks', 'carriage-return', 'line-endings', 'eol']",en,hiding sometimes need read log files controlm line endings global replace get rid something logged log file course emacslinebreakscarriagereturningendingseol russell asked apr
262"periodic chrome page rerender clears all canvases. is this documented behaviour, and if so how can i prevent it? periodically, chrome will rerender the entire page. this is perhaps because it runs out of memory for the tab? my app uses a lot of memory. the screen appears to entirely blank, and then the dom ... javascripthtmlgoogle-chromecanvas sebi s 65 asked may 26, 2024 at 23:01","['javascript', 'html', 'google-chrome', 'canvas']",en,periodic chrome page defender clears canvases documented behaviour prevent periodically chrome defender entire page perhaps runs memory tab app uses lot memory screen appears entirely blank dom javascripthtmlgooglechromecanvas semi asked may
263"how to design card widget in flutter i'm trying to design a student dashboard , and am wondering how to add the blue color at the end of this card widget where the text( student, news ) are inserted ? flutterdart lina saeed 101 asked apr 8, 2022 at 19:13","['flutter', 'dart']",en,design card widget clutter trying design student dashboard wondering add blue color end card widget text student news inserted flutterdart lina seed asked apr
264"docker - error: connection lost: the server closed the connection [closed] i'm trying to connect to mysql database from mysql image in docker using docker-compose with nestjs project . but the connection gives me this error : error: connection lost: the server closed the ... mysqldockerdocker-compose jaafar melhem 410 asked nov 17, 2023 at 9:35","['mysql', 'docker', 'docker-compose']",en,decker error connection lost server closed connection closed trying connect database image decker using deckercompose nests project connection gives error error connection lost server closed mysqldockerdockercompose jaar melted asked nov
265"how to change the date format in the datepicker of angular ngx-bootstrap inside a form using ngx-bootstrap datepicker in an angular 4 application, i know that normally you can specify the date format this way: <input id=""from"" name=""from"" bsdatepicker [(bsvalue)]=""mymodel"" ... angulardatepickerangular2-ngmodelangular-formsngx-bootstrap francesco borzi 62.4k asked sep 11, 2017 at 15:41","['angular', 'datepicker', 'angular2-ngmodel', 'angular-forms', 'ngx-bootstrap']",en,change date format datepicker angular ngxbootstrap inside form using ngxbootstrap datepicker angular application know normally specify date format way input idfrom namefrom bsdatepicker valuemodel angulardatepickerangularngmodelangularformingbootstrap francesco born k asked sep
266"laravel inertia (react), post without defining route? i'm new to laravel and react, currently trying to build a small project by using these two framework. so i have installed breeze and react package, trying to figure it out how register process go ... reactjslaravelpostroutesinertiajs jim 33 asked jul 30, 2023 at 16:14","['reactjs', 'laravel', 'post', 'routes', 'inertiajs']",en,travel inertia react post without defining route new travel react currently trying build small project using two framework installed breeze react package trying figure register process go reactjslaravelpostroutesinertiajs jim asked jul
267"add in a list from an api rest in jetpack compose functionality: this is a card game in which each player has a series of cards that are superheroes that i take from a superhero api, all with powestates, these abilities define the power of the card ... multithreadingkotlinandroid-jetpack-composeretrofit jorge 1 asked feb 14, 2024 at 0:40","['multithreading', 'kotlin', 'android-jetpack-compose', 'retrofit']",en,add list api rest setback compose functionality card game player series cards superheroes take superhero api powestates abilities define power card multithreadingkotlinandroidsetbackcomposeretrofit jorge asked feb
268"extracting multiple values from string with regex i need to extract some data from a file to convert it to an object in order to be processed. i receive the data in a text file with the following format: card 1: 32 45 ... 88 1 and my model is: ... javaregex alvaro pedraza 1,292 asked dec 26, 2023 at 23:54","['java', 'regex']",en,extracting multiple values string regex need extract data file convert object order processed receive data text file following format card model javaregex lvaro pedraza asked dec
269"how to increase the canvas to fill the full width i have a few elements which covers the half of width of full window. i had to fixed the size of window but how do i get the full width of windows and assign the value to width1 and width2. i have ... javascripthtmlcss sagar rawal 399 asked mar 6, 2024 at 19:30","['javascript', 'html', 'css']",en,increase canvas fill full width elements covers half width full window fixed size window get full width windows assign value width width javascripthtmlcss sugar away asked mar
270"how to create a json web token (jwt) using openssl shell commands? i'm trying to create a json web token (jwt) using command line utilities on macos and hitting a snag with the signing portion. i was greatly inspired by this gist: https://gist.github.com/indrayam/... linuxbashopenssljwthmac jordan reed 596 asked nov 22, 2019 at 23:10","['linux', 'bash', 'openssl', 'jwt', 'hmac']",en,create son web token jet using opens commands trying create son web token jet using command line utilities marcos hitting snag signing portion greatly inspired gist linuxbashopenssljwthmac jordan reed asked nov
271"problem with generating querydsl classes with gradle i want to generate 'q' classes using querydsl. the problem that i'm facing is described by errors: > task :compilejava failed attempt to recreate a file for type com.my.dinner.rest.database.entity.... javagradleintellij-ideaquerydsl dappy 89 asked jun 22, 2020 at 18:38","['java', 'gradle', 'intellij-idea', 'querydsl']",en,problem generating querydsl classes grade want generate q classes using querydsl problem facing described errors task compilejava failed attempt recreate file type commydinnerrestdatabaseentity javagradleintellijideaquerydsl happy asked jun
272"optimizing mobile layout in avada: maintaining 4 columns on desktop and displaying 2 columns on mobile devices in wordpress, using the avada theme, a site configured with four columns defaults to a single-column layout on mobile devices. conversely, configuring the site with six columns results in a two-column ... wordpress luca di ferdinando 30 asked dec 14, 2023 at 8:59",['wordpress'],en,optimizing mobile layout aaa maintaining columns desktop displaying columns mobile devices wordpress using aaa theme site configured four columns defaults singlecolumn layout mobile devices conversely configuring site six columns results twocolumn wordpress luca di fernando asked dec
273"react native how to execute function every time when i open page i need to send request every time when i open page. currently when i access page first time after load the app everything is ok, but if i go to another page and back after that request is not send it ... react-native любомир мариянов 51 asked nov 21, 2020 at 16:09",['react-native'],en,react native execute function every time open page need send request every time open page currently access page first time load app everything ok go another page back request send reactnative liubomir mariianov asked nov
274"angular 6 - can't resolve all parameters for appcomponent i am trying to build an application with angular 6 and i am still setting everything up. but it seems there is something wrong with the dependency injection in my app. it cannot resolve any ... angulartypescriptdependency-injectionangular6ngx-translate mr.wiseguy 4,252 asked jun 21, 2018 at 10:04","['angular', 'typescript', 'dependency-injection', 'angular6', 'ngx-translate']",en,angular cannot resolve parameters appcomponent trying build application angular still setting everything seems something wrong dependency injection app cannot resolve angulartypescriptdependencyinjectionangularngxtranslate mrwisely asked jun
275"how do i exclude the _id & __v properties when querying or creating a mongoose document (in nestjs)? in my nestjs backend app i have this user schema: import { prop, schema, schemafactory } from '@nestjs/mongoose'; import { document } from 'mongoose'; @schema({ versionkey: false, tojson: { ... typescriptmongoosenestjsmongoose-schema yannick 33 asked aug 30, 2023 at 9:53","['typescript', 'mongoose', 'nestjs', 'mongoose-schema']",en,exclude id v properties burying creating mongoose document nests nests backend app user schema import prop schema schemafactory nestsmongoose import document mongoose schema versionkey false poison typescriptmongoosenestjsmongooseschema yannick asked aug
276"dropbear login attempt for nonexistent user while user exists in the system i wanted to have a ssh server on my embedded linux system, so i tried to install dropbear by compiling it and installing the binary in the file system. on that embedded system, i use busybox. i have ... sshembedded-linuxdropbear patacoing 127 asked mar 18, 2023 at 15:30","['ssh', 'embedded-linux', 'dropbear']",en,dropbear login attempt nonexistent user user exists system wanted ssh server embedded linux system tried install dropbear compiling installing binary file system embedded system use busybox sshembeddedlinuxdropbear patacoing asked mar
277"next-pwa non-stop refresh on offline mode i'm using next-pwa and next-translate i used middleware to support multi-tenant (middleware rewrites user's requests to it's organization's page) it's the abridged version of the middleware:
... next.jsnext-pwanext-translate navid nourani 13 asked nov 14, 2023 at 5:11","['next.js', 'next-pwa', 'next-translate']",en,nextpa nonstop refresh offline mode using nextpa nexttranslate used middleware support multitenant middleware rewrites users requests organizations page abridged version middleware nextnextplanettranslate navid courant asked nov
278"realm object with dictionary of [string: any] to save the json value in the property player object model in the player model, i want to save the json response so that i will get any new computed properties in the future without changing the schema. but here, i'm getting the error to ... realmrealm-mobile-platformrealm-migrationrealm-ios ping2karthikeyan 11 asked jan 6, 2023 at 14:00","['realm', 'realm-mobile-platform', 'realm-migration', 'realm-ios']",en,realm object dictionary string save son value property player object model player model want save son response get new computed properties future without changing schema getting error realmrealmmobileplatformrealmmigrationrealmios pingkarthikeyan asked jan
279"sdl2 w/ cmake fetchcontent and mingw [duplicate] i'm trying to make a sdl2 project in c++, which i've managed to get working using clang++, i would just like a better way to receiving sdl2 libraries, and cmake seems like a good option here, with it'... c++cmakemingwsdl naginipython 45 asked feb 24, 2024 at 16:35","['c++', 'cmake', 'mingw', 'sdl']",en,sl w make fetchcontent ming duplicate trying make sl project c managed get working using lang would like better way receiving sl libraries make seems like good option ccmakemingwsdl naginipython asked feb
280"how to fix phpmailer password command failed issue? i am using hostinger. i just got an email through them. i keep getting the following error.. 2023-11-30 18:58:51 server -> client: 535 5.7.8 error: authentication failed: ugfzc3dvcmq6 2023-11-30 18:... phphostingphpmailer justin buzek 1 asked nov 30, 2023 at 19:07","['php', 'hosting', 'phpmailer']",en,fix phpmailer password command failed issue using hosting got email keep getting following error server client error authentication failed ufcdvcmq phphostingphpmailer justin buses asked nov
281"you have to be inside an angular-cli project in order to use the serve command i am trying to run a drag and drop sample from dragula.but when i run ng serve it complains with : you have to be inside an angular-cli project in order to use the serve command. when i run ng -v in ... angular sal-las 11.7k asked nov 30, 2016 at 11:57",['angular'],en,inside angularcli project order use serve command trying run drag drop sample dragulabut run ng serve complains inside angularcli project order use serve command run ng v angular sallas k asked nov
282"nodejs: no 'access-control-allow-origin' header is present on the requested resource my client (react app) and server (node project) run on different ports. i'm trying to make an api request from the frontend to the backend, and am getting this error message in the frontend console: ... node.jsreactjsaxioscors westerncreamcheese 173 asked jul 2, 2023 at 3:04","['node.js', 'reactjs', 'axios', 'cors']",en,nodes accesscontrolalloworigin header present requested resource client react app server node project run different ports trying make api request frontend backend getting error message frontend console nodejsreactjsaxioscors westerncreamcheese asked jul
283use github’s oidc feature to authenticate directly to azure entra id i have an app registration with federated credentials for scenario 'github federated credential'. i've created a test workflow to validate that it authenticates successfully against my azure ... microsoft-graph-apigithub-actionsopenid-connect d k 111 asked 20 hours ago,"['microsoft-graph-api', 'github-actions', 'openid-connect']",en,use githubs oid feature authenticate directly azure entra id app registration generated credentials scenario github generated credential created test workflow validate authenticate successfully azure microsoftgraphapigithubactionsopenidconnect k asked hours ago
284"python import from local folder using vs code? i'm using vs code and a conda venv. i have created a folder called ""project"" and in the folder i have 3 sub folders ""helper"", ""function"", ""function2"". now i ... pythonvisual-studio-code azuser1 193 asked jul 18, 2023 at 12:11","['python', 'visual-studio-code']",en,python import local folder using vs code using vs code honda vent created folder called project folder sub folders helper function function pythonvisualstudiocode abuser asked jul
285"jetpack compose how to blur text area and line it to the bottom of a card i want to place text at the bottom of a card and blur the text area with a translucent color. this is what i have so far. the design i am trying to achieve is this. (collection area with cards ... androidkotlinandroid-jetpack-compose abdul fertah 393 asked apr 22, 2022 at 5:59","['android', 'kotlin', 'android-jetpack-compose']",en,setback compose blur text area line bottom card want place text bottom card blur text area translucent color far design trying achieve collection area cards androidkotlinandroidsetbackcompose abdul forth asked apr
286"save a for loop value after each iteration and sum those values for a total (without using a function) i really hate to ask this here as it feels like it should be super simple to figure out. i have been racking my brain for half the day on this trying multiple ways and cannot seem to figure it out. ... c++arraysfor-loopif-statementiteration label07 31 asked nov 21, 2023 at 0:15","['c++', 'arrays', 'for-loop', 'if-statement', 'iteration']",en,save loop value iteration sum values total without using function really hate ask feels like super simple figure racing brain half day trying multiple ways cannot seem figure carraysforloopstatementiteration label asked nov
287"unable to inject custom @jsonfilter in springboottest i have a data class for which i use a custom jsonfilter @jsonfilter(value = ""conditional_serializers"") data class documentrequest( val somefield: string? = null, val someotherfield: ... hibernatejacksonjson-deserializationspring-boot-test makruzz 127 asked jun 4, 2024 at 10:54","['hibernate', 'jackson', 'json-deserialization', 'spring-boot-test']",en,unable inject custom jsonfilter springboottest data class use custom jsonfilter jsonfiltervalue conditionalserialized data class documentrequest val somefield string null val someotherfield hibernatejacksonjsondeserializationspringboottest makruzz asked jun
288"i keep getting errors of undefined bitfields on discord.js v14 this is the error referenceerror: permissionsbitfield is not defined at object.execute (/home/runner/nodejs-1/commands/kick.js:20:82) at client.<anonymous> (/home/runner/nodejs-1/index.js:25:23)... javascriptdiscord sabaii 1 asked feb 23, 2024 at 13:32","['javascript', 'discord']",en,keep getting errors undefined airfields discordjs v error referenceerror permissionsbitfield defined objectexecute homerunnernodescommandskickjs client homerunnernodesindexjs javascriptdiscord hawaii asked feb
289"how to remove thumbnail toolbar in uwp i enable backgroundmediaplayback function in my uwp app. and this causes a media control appearing in preview thumbnail when mouse is hovering on taskbar button. according microsoft learn, it is ... c#uwpbackgroundmediaplaybackthumbnail-toolbar vincent 81 asked mar 6, 2024 at 9:31","['c#', 'uwp', 'background', 'mediaplayback', 'thumbnail-toolbar']",en,remove thumbnail toolbar enable backgroundmediaplayback function app causes media control appearing preview thumbnail mouse hovering taskbar button according microsoft learn cuwpbackgroundmediaplaybackthumbnailtoolbar vincent asked mar
290"decoding azure access token obtained by client credential flow got access token using azure.identity clientsecretcredential client credential flow but when trying to decode using the pyjwt library giving me the below error. valueerror: could not deserialize key ... oauthazure-identityclientcredentialazure-oauth m9m9m 1,721 asked jul 20, 2023 at 12:42","['oauth', 'azure-identity', 'clientcredential', 'azure-oauth']",en,decoding azure access token obtained client credential flow got access token using azureidentity clientsecretcredential client credential flow trying decode using pyjwt library giving error valueerror could deserialize key oauthazureidentityclientcredentialazureoath mmm asked jul
291"how to pivot data and create a list i have a dataset (dummy data set below). i need to pivot it wider but also create a list with each level being by 'block' block<-c(""a1"",""a1"",""a1"",""a1"",""... rdplyrtidyr amanda goldberg 383 asked 2 days ago","['r', 'dplyr', 'tidyr']",en,pivot data create list dataset dummy data set need pivot wider also create list level block blockcaaaa rdplyrtidyr amanda goldberg asked days ago
292"how to simplify my double loops by matlab vectorization? my code is : n = 500; % d_1=ones(n,n);% d_2=ones(n,n);% for simplicity. b=zeros(n,n); for i = 1:n for j = i+1:n basis_vector = zeros(n, 1); basis_vector(i) = 1; ... matlabfor-looptime-complexityvectorizationsimplify jie zhou 45 asked jan 31, 2024 at 9:18","['matlab', 'for-loop', 'time-complexity', 'vectorization', 'simplify']",en,simplify double loops atlas factorization code n donesnn donesnn simplicity bzerosnn n j basisvector zerosn basisvectori matlabforlongtimecomplexityvectorizationsimplify jie hou asked jan
293"how to fill an avframe structure in order to encode an yuy2 video (or uyvy) into h265 i want to compress a video stream in yuy2 or uyvy format to, say h265. if i understand the answers given this thread correctly, i should be able use the function av_image_fill_arrays() to fill the ... c++ffmpeg rich deng 1 asked apr 18 at 17:08","['c++', 'ffmpeg']",en,fill average structure order encode buy video navy h want compress video stream buy navy format say h understand answers given thread correctly able use function avimagefillarrays fill cmpeg rich eng asked apr
294"databricks sql queries taking long time to execute without join key/field the following query will take over one hour to execute: select distinct t.tradeamount from crm.newtransaction t left outer join drd.pricehistoric pph on t.tradedate = pph.pricedate when i add the ... azureazure-databricksdatabricks-sql patterson 2,875 asked may 10, 2024 at 10:17","['azure', 'azure-databricks', 'databricks-sql']",en,databricks sql queries taking long time execute without join keyfield following query take one hour execute select distinct ttradeamount crmnewtransaction left outer join didprehistoric pp ttradename pppredate add azureazuredatabricksdatabrickssql patterson asked may
295"how to change container name and image in kustomization.yaml i want to change all the dev-app to demo-app using kustomization. in my base deployment.yaml i have the following: apiversion: extensions/v1beta1 kind: deployment metadata: labels: service: dev-... kubernetesdeploymentkustomize sachin sooraj 11 asked jan 24, 2023 at 8:52","['kubernetes', 'deployment', 'kustomize']",en,change container name image customizationyam want change devapp demoapp using customization base deploymentyam following diversion extensionsvbeta kind deployment metadata labels service dev kubernetesdeploymentkustomize machine sora asked jan
296"too many redirects error using cloudflare i redirected two urls from one of my sites to another. those two site redirects are working fine however all the other pages including the home url are giving a err_too_many_redirects error . it was ... wordpresssslhttp-redirectdnscloudflare matt trav 23 asked aug 16, 2023 at 11:59","['wordpress', 'ssl', 'http-redirect', 'dns', 'cloudflare']",en,many redirects error using cloudflare redirected two urls one sites another two site redirects working fine however pages including home url giving errtoomanyredirects error wordpresssslhttpredirectdnscloudflare matt trap asked aug
297"extract @layer styles from css / scss and output to file is it somehow possible using vite and sass to extract styles of a specific css @layer from a stylesheet and output those styles into a separate file? the idea is to add an layer critical and output ... csssassvitecss-layer code spirit 5,111 asked may 9, 2024 at 17:37","['css', 'sass', 'vite', 'css-layer']",en,extract layer styles css css output file somehow possible using site says extract styles specific css layer stylesheet output styles separate file idea add layer critical output csssassvitecsslayer code spirit asked may
298"maven generating pom file i use maven 3.0.3 and have tried to generate pom for third-party jar like this: mvn install:install-file -dfile=cobra.jar -dgroupid=com.cobra -dartifactid=cobra -dversion=0.98.4 -dpackaging=jar -... mavenmaven-3pom.xml firen 1,424 asked jul 15, 2011 at 9:05","['maven', 'maven-3', 'pom.xml']",en,generating pom file use tried generate pom thirdparty jar like men installinstallfile filecobrajar groupedcomcobra dartifactidcobra version packagingjar mavenmavenpomxml fire asked jul
299"pycharm does not recognize modules installed in development mode i have two pure python projects in pycharm 3.4.1 professional edition. the first one, let's call it p (like package), is structured as a setuptools package (i.e. with setup.py, all requirements etc., ... pythonpython-3.xpycharmsetuptools zegkljan 8,429 asked oct 4, 2014 at 13:36","['python', 'python-3.x', 'pycharm', 'setuptools']",en,charm recognize modules installed development mode two pure python projects charm professional edition first one let us call p like package structured setuptools package ie setuppy requirements etc pythonpythonxpycharmsetuptools zegkljan asked oct
300"how to use socket.io-client in angular 4 server side is php laravel echo websocket and i am trying to connect by angular 4. i tried using ng2-socket-io - npm and also laravel-echo - npm but none of them were successfully. if anyone know any ... javascriptangulartypescriptsocket.iolaravel-echo giga songulashvili 469 asked nov 7, 2017 at 15:27","['javascript', 'angular', 'typescript', 'socket.io', 'laravel-echo']",en,use socketioclient angular server side php travel echo websocket trying connect angular tried using ngsocketio num also travelecho num none successfully anyone know javascriptangulartypescriptsocketiolaravelecho liga songulashvili asked nov
301"is aws datapipeline service being deprecated? when i navigate to aws datapipeline console it shows this banner, please note that data pipeline service is in maintenance mode and we are not planning to expand the service to new regions. we plan ... amazon-web-servicesdeprecation-warningamazon-data-pipeline dinuka salwathura 944 asked dec 13, 2022 at 9:22","['amazon-web-services', 'deprecation-warning', 'amazon-data-pipeline']",en,aws datapipeline service deprecated navigate aws datapipeline console shows banner please note data pipeline service maintenance mode planning expand service new regions plan amazonwebservicesdeprecationwarningamazondatapipeline minuta salwathura asked dec
302"dynamic control generic react-hook-form. getting error ts2322: type 'control<formfields, any>' is not assignable to type 'control<fieldvalues, any>' in my app i use react-hook-form with last version of mui 5.11. i have made reusable select component: ...someimports import { control, controller } from 'react-hook-form'; interface selectprops { ... reactjstypescriptmaterial-uireact-hook-form pttrulez 175 asked jan 18, 2023 at 4:54","['reactjs', 'typescript', 'material-ui', 'react-hook-form']",en,dynamic control generic reacthookform getting error ts type control assignable type control app use reacthookform last version mui made reusable select component someimports import control controller reacthookform interface selectprops reactjstypescriptmaterialdirecthookform pttrulez asked jan
303"how to fix express.js and @nestjs/core vulnerabilities in a fresh nestjs project without introducing breaking changes? i've just initiated a new project with nestjs and upon running npm audit, i encountered some moderate severity vulnerabilities related to both express and @nestjs/core the vulnerabilities are: ... expressnestjs mrn3o 206 asked mar 26, 2024 at 1:17","['express', 'nestjs']",en,fix expressjs nestscore vulnerabilities fresh nests project without introducing breaking changes initiated new project nests upon running num audit encountered moderate severity vulnerabilities related express nestscore vulnerabilities expressnestjs meno asked mar
304"evaluating separate mongodb databases for each collection vs. consolidating all collections into a single database [closed] i’m designing a backend service that uses mongodb, and i’m trying to decide how to organize my data. i have roughly a dozen collections—each corresponding to a distinct domain (e.g. users, orders, ... mongodbmongodb-query zeus 13.1k asked apr 20 at 9:28","['mongodb', 'mongodb-query']",en,evaluating separate mongodb databases collection vs consolidating collections single database closed designing backend service uses mongodb trying decide organize data roughly dozen collectionseach corresponding distinct domain eg users orders mongodbmongodbquery news k asked apr
305"no ability to add a wcf web service to a .net 6.0 vb.net winforms app i can't seem to add a wcf web service to a winforms .net 6 application in vs2022. all i see is ""connected services"" and the ability to add a ""service dependency"". i have included ... wcf.net-core user2413934 asked sep 17, 2023 at 13:54","['wcf', '.net-core']",en,ability add cf web service net vbnet informs app cannot seem add cf web service informs net application vs see connected services ability add service dependency included cfnetcore user asked sep
306"building both amd64 and arm64 with github workflows from different files what is the correct way to setup github workflow for the multi-platform (amd64+arm64) docker image build? i have two different docker files, one for each platform (see maplibre/martin project), and i ... dockergithub-actions yuri astrakhan 10.1k asked mar 29, 2023 at 3:34","['docker', 'github-actions']",en,building amd arm github workflow different files correct way setup github workflow multiplatform amdarm decker image build two different decker files one platform see calibremartin project dockergithubactions yuri astrakhan k asked mar
307"bootstrap 5 center image i tried centering an image horizontally my giving the parent div the class justify-content-center as well as text-center. this worked for any text, however the image remains to the left, rather than ... csstwitter-bootstrapbootstrap-5 alex 609 asked jun 12, 2023 at 16:54","['css', 'twitter-bootstrap', 'bootstrap-5']",en,bootstrap center image tried centering image horizontally giving parent div class justifycontentcenter well textcenter worked text however image remains left rather csstwitterbootstrapbootstrap alex asked jun
308"authentication failure while trying to save to mongodb i have following code to save to a local running mongo instance: mongocredential credential = mongocredential.createcredential(""myuser"", ""mydatabase"", ""mypassword"".... mongodb mandroid 7,570 asked sep 5, 2020 at 14:02",['mongodb'],en,authentication failure trying save mongodb following code save local running mono instance mongocredential credential mongocredentialcreatecredentialuser database password mongodb android asked sep
309"flutter builded app (apk) doesn't launch on my mobile phone when i download the app it just crashes without even opening. asks me to clear the cache and try again. i tried to change the sdk versions in build.gradle to match my phone. still doesn't launch. ... androidflutterdartbuildapk morybuzz 23 asked aug 11, 2024 at 5:00","['android', 'flutter', 'dart', 'build', 'apk']",en,clutter builder app apk launch mobile phone download app crashes without even opening asks clear cache try tried change sdk versions buildgrade match phone still launch androidflutterdartbuildapk morybuzz asked aug
310"chi sqaure test - why null (h0) and alternative (h1) hypothesis testing result is coming wrong or there is something wrong in my understanding from scipy.stats import chi2_contingency # defining the table data = [[1,2,3,4,5,], [10,20,30,40,50]] stat, p, dof, expected = chi2_contingency(data) # interpret p-value alpha = 0.05 print(""... pythonscipy arnab biswas 1 asked jan 23, 2024 at 6:44","['python', 'scipy']",en,chi square test null h alternative h hypothesis testing result coming wrong something wrong understanding citystats import chicontingency defining table data stat p expected chicontingencydata interpret pvalue alpha print pythonscipy arab bias asked jan
311"get calendar events of all group members via power automate i want to get the calendar events of all of the members in the organization/team via power automate. as i see now the ""get calendars (v2)"" and the ""get calendar view of events (v3)""... power-automate cycero 4,781 asked jun 1, 2023 at 12:20",['power-automate'],en,get calendar events group members via power automate want get calendar events members organizationteam via power automate see get calendars v get calendar view events v powerautomate cyber asked jun
312"sns mocking with moto is not working correctly in my unit test: def test_my_function_that_publishes_to_sns(): conn = boto3.client(""sns"", region_name=""us-east-1"") mock_topic = conn.create_topic(name=""mock-topic""... pythonamazon-web-servicesunit-testingbotomoto red888 31.9k asked may 26, 2020 at 5:31","['python', 'amazon-web-services', 'unit-testing', 'boto', 'moto']",en,sns mocking moto working correctly unit test def testmyfunctionthatpublishestosns conn bothclientsns regionnameuseast mocktopic conncreatetopicnamemocktopic pythonamazonwebservicesunittestingbotomoto red k asked may
313"python: tuples/dictionaries as keys, select, sort suppose i have quantities of fruits of different colors, e.g., 24 blue bananas, 12 green apples, 0 blue strawberries and so on. i'd like to organize them in a data structure in python that allows for ... pythonselectdictionarykeytuples nico schlömer 59.1k asked feb 2, 2011 at 19:24","['python', 'select', 'dictionary', 'key', 'tuples']",en,python rulesdictionaries keys select sort suppose quantities fruits different colors eg blue bananas green apples blue strawberries would like organize data structure python allows pythonselectdictionarykeytuples nico schlomer k asked feb
314"remove duplicates based on combination of two columns in pandas i need to delete duplicated rows based on combination of two columns (person1 and person2 columns) which have strings. for example person1: ryan and person2: delta or person 1: delta and person2: ryan ... pythonpandasdataframeduplicates aaa 392 asked dec 6, 2022 at 18:45","['python', 'pandas', 'dataframe', 'duplicates']",en,remove duplicates based combination two columns panda need delete duplicated rows based combination two columns person person columns strings example person ryan person delta person delta person ryan pythonpandasdataframeduplicates aaa asked dec
315"lwip stack / modified echo server example -> sending data i'm using an arty a7 board and have implemented the echo server example on it. it works without any problems. i then modified the code to send back other data. it works, but only via the receive ... ctcplwipmicroblaze tobias 1 asked aug 21, 2023 at 13:25","['c', 'tcp', 'lwip', 'microblaze']",en,lip stack modified echo server example sending data using party board implemented echo server example works without problems modified code send back data works via receive ctcplwipmicroblaze topics asked aug
316"ie11 css alternative to ""unset"" i have a fixed div on my page which is positioned with the following css properties: width: 320px; height: 160px; position: fixed; right: 15px; bottom: 15px; top: unset; z-index: -1; the div appears ... csshtmlinternet-explorer-11 mike 1,735 asked jan 24, 2018 at 14:56","['css', 'html', 'internet-explorer-11']",en,ie css alternative unset fixed div page positioned following css properties width px height px position fixed right px bottom px top unset zindex div appears csshtmlinternetexplorer mike asked jan
317"should i recommend sealing classes by default? in a big project i work for, i am considering recommending other programmers to always seal their classes if they haven't considered how their classes should be subclassed. often times, less-... c#java.netoop carlo v. dango 13.9k asked jun 17, 2011 at 17:24","['c#', 'java', '.net', 'oop']",en,recommend sealing classes default big project work considering recommending programmers always seal classes considered classes subclassis often times less cjavanztop carlo v tango k asked jun
318"save the position of scrollview when the orientation changes these is my layout: i need to save the scrolling position when the orientation changes. for example if the screen shows layout starting from middle name in portrait mode,it should start from same in ... androidandroid-layoutorientation user1945196 asked mar 23, 2015 at 10:35","['android', 'android-layout', 'orientation']",en,save position scrollview orientation changes layout need save scrolling position orientation changes example screen shows layout starting middle name portrait modeit start androidandroidlayoutorientation user asked mar
319"what is the best way to handle an enemy that collides but on different layer than player in godot? i'm trying to create a platform runner game. i have an enemy that runs towards the player and self destroy when off screen. since the enemy is running on floor, i have a characterbody2d . i don't ... godotgodot4 user1865027 3,667 asked jul 24, 2023 at 3:39","['godot', 'godot4']",en,best way handle enemy collides different layer player odot trying create platform runner game enemy runs towards player self destroy screen since enemy running floor characterbodyd godotgodot user asked jul
320"how to get the current project name in c# code? i want to send an email to myself when an exception is thrown. using stackframe object, i am able to get file name, class name and even class method that throw the exception, but i also need to know ... c#asp.netexception j - c sharper 1,707 asked aug 19, 2013 at 14:45","['c#', 'asp.net', 'exception']",en,get current project name c code want send email exception thrown using stackframe object able get file name class name even class method throw exception also need know caspnetexception j c sharper asked aug
321"local azure functions load local.settings.json from core tools runtime folder and not from working directory i am working on several azure functions v4 with .net6.0 at the moment. when trying to start the app locally, i realized that my local.settings.json is not properly loaded. before continuing, here is ... c#.netazure-functionsazure-functions-core-tools jörg 3 asked apr 24, 2023 at 9:56","['c#', '.net', 'azure-functions', 'azure-functions-core-tools']",en,local azure functions load localsettingsson core tools runtime folder working directory working several azure functions v net moment trying start app locally realized localsettingsson properly loaded continuing cnetazurefunctionsazurefunctionscoretools jorg asked apr
322"is there a version of ""microsoft.extensions.hosting"" for .net framework 4.8 [closed] the version of ""microsoft.extensions.hosting"" on nuget has the following dependencies: given that .net framework 4.8 is the one for long-term support, it seems strange that it is not an ... c#microsoft.extensions.hosting ant waters 580 asked sep 26, 2023 at 15:35","['c#', 'microsoft.extensions.hosting']",en,version microsoftextensionshosting net framework closed version microsoftextensionshosting nugget following dependencies given net framework one longterm support seems strange cmicrosoftextensionshosting ant waters asked sep
323"if condition ignored in vsc in vsc my if got skipped and it went straight for the else condition. here's the code, thank you for helping ;-; #include <stdio.h> #include <ctype.h> int main() { char questions[][... c khang nguyên 23 asked jun 26, 2024 at 4:48",['c'],en,condition ignored vs vs got skipped went straight else condition code thank helping include include int main char questions c khan guyen asked jun
324"delete azure blob contents before copy i’m creating an azure pipeline that does the following: gets last artifact copies that artifact to an azure container this works but i need to delete everything in the container before copying. ... azureazure-pipelinesazure-blob-storage peter jetta 27 asked jun 30, 2023 at 10:13","['azure', 'azure-pipelines', 'azure-blob-storage']",en,delete azure blob contents copy creating azure pipeline following gets last artifact copies artifact azure container works need delete everything container copying azureazurepipelinesazureblobstorage peter jetty asked jun
325"aws cost and usage report difference from aws billing dashboard i have an activated aws service called aws cost and usage report(cur), which generates on an hourly basis. the format of the cur is in parquet format. i have a python code that takes the parquet and ... pythonamazon-web-servicesparquetaws-cost-explorer not a robot 2,692 asked feb 27, 2024 at 8:51","['python', 'amazon-web-services', 'parquet', 'aws-cost-explorer']",en,aws cost usage report difference aws billing dashboard activated aws service called aws cost usage reportcur generates hourly basis format cur parque format python code takes parque pythonamazonwebservicesparquetawscostexplorer robot asked feb
326"flutter firebase messaging not receiving messages from backend on ios (works on android and with firebase console) i'm having an issue with firebase cloud messaging in my flutter app where: on ios: messages only work when sent via firebase console, but not when sent from my backend on android: messages ... flutterfirebasegoogle-cloud-functionsfirebase-cloud-messaging dali hmida 43 asked yesterday","['flutter', 'firebase', 'google-cloud-functions', 'firebase-cloud-messaging']",en,clutter fishbase messaging receiving messages backend ios works android fishbase console issue fishbase cloud messaging clutter app ios messages work sent via fishbase console sent backend android messages flutterfirebasegooglecloudfunctionsfirebasecloudmessaging dali pmid asked yesterday
327"subfolder uploaded to the main folder of the project instead of the dir path indicated under 'directory' input (github-push-action) i'm trying to commit some files and folders to a subfolder of my main project, but all the documents end up in a pull request in the wrong location. in some part of my workflow, i have this output: ... githubgithub-actionsgit-push matteemol 21 asked apr 7, 2024 at 7:22","['github', 'github-actions', 'git-push']",en,suborder uploaded main folder project instead dir path indicated directory input githubpushaction trying commit files folders suborder main project documents end pull request wrong location part workflow output githubgithubactionsgitpush matteemol asked apr
328"excel stored query connection credentials i have a query that pulls from a sql server db in excel and i'm wondering if there's a way to input the username and password credentials in the connection string? otherwise, i will have to remotely ... excelvbapowerqueryoledb dane cameron 433 asked aug 23, 2023 at 14:20","['excel', 'vba', 'powerquery', 'oledb']",en,excel stored query connection credentials query pulls sql server db excel wondering way input username password credentials connection string otherwise remotely excelvbapowerqueryoledb dane cameron asked aug
329"solarium solr ssl issue i am using pantheon's hosting environment for wordpress websites. i am building a custom plugin that integrates solr into the wordpress search. i am using docker and was able to spin up a solr server ... phpwordpresssolrsolariumpantheon cameron 799 asked apr 11, 2024 at 19:01","['php', 'wordpress', 'solr', 'solarium', 'pantheon']",en,solarium sold ssl issue using pantheons hosting environment wordpress websites building custom plugin integrates sold wordpress search using decker able spin sold server phpwordpresssolrsolariumpantheon cameron asked apr
330"send email with user form using nodemailer i have my website working live i have a form for user if user or visitors who want ask any question can send me his her request by filling that form and when user click on submit button all data ... node.jsexpressnodemailer iram imran 5 asked feb 20, 2024 at 11:20","['node.js', 'express', 'nodemailer']",en,send email user form using nodemailer website working live form user user visitors want ask question send request filling form user click submit button data nodejsexpressnodemailer tram iran asked feb
331"how to make the innermost navigatorpophandler handle the back gesture on android with flutter? it seems that the back gesture only gets handled by the outermost navigatorpophandler. i would expect the innermost active navigatorpophandler to receive the pop request. minimal reproducible example: ... flutter anakhand 3,058 asked apr 5, 2024 at 18:13",['flutter'],en,make innermost navigatorpophandler handle back gesture android clutter seems back gesture gets handled outermost navigatorpophandler would expect innermost active navigatorpophandler receive pop request minimal reproducible example clutter anakhand asked apr
332"install libraries in vs studio using cmake i am trying to compute the eigenvalues for the hamiltonian for the 1d ising model in a transverse field using c in vs studio. however, i need to use the lapack library and i am struggling with cmake ... cvisual-studio-codelapack samuelmsoares 39 asked aug 13, 2024 at 19:57","['c', 'visual-studio-code', 'lapack']",en,install libraries vs studio using make trying compute eigenvalues hamiltonian using model transverse field using c vs studio however need use lack library struggling make visualstudiocodelapack samuelmsoares asked aug
333"gcc-multilib not found but gcc is installed mac m1 gcc is installed. while building docker image got the error #0 4.414 package gcc-multilib is not available, but is referred to by another package. #0 4.414 this may mean that the package is missing, ... dockergcc sh33r 19 asked jul 9, 2022 at 3:15","['docker', 'gcc']",en,gccmultilib found gcc installed mac gcc installed building decker image got error package gccmultilib available referred another package may mean package missing dockergcc shr asked jul
334"android drag & drop for reordering lists detectdraggesturesafterlongpress shorten long press wait i have used a google sample app to implement list reording in my compose lazycolumn list and it all works fine. the issue i have is that this implementation empoys detectdraggesturesafterlongpress ... androiddrag-and-dropandroid-jetpack-compose hector 5,528 asked jun 12, 2024 at 9:28","['android', 'drag-and-drop', 'android-jetpack-compose']",en,android drag drop rendering lists detectdraggesturesafterlongpress shorten long press wait used google sample app implement list recording compose lazycolumn list works fine issue implementation employs detectdraggesturesafterlongpress androiddraganddropandroidsetbackcompose hector asked jun
335"how to form a github graphql api query to compare between branches, e.g., compare master and sample_12 to get all commits for potential pull request? looking for a graphql query to search for a list of all commits when comparing between two branches on github within a repository. for example, https://github.com/account-test/repo-test/compare/main...... githubgraphqlgithub-api user16829669 1 asked aug 2, 2023 at 1:40","['github', 'graphql', 'github-api']",en,form github graphic api query compare branches eg compare master sample get commits potential pull request looking graphic query search list commits comparing two branches github within repository example githubgraphqlgithubapi user asked aug
336"how to make an image non-selectable in css? i'm making a html & css website. i want to put an image in there which people can not select (or drag). earlier, user-select: none worked on images and texts, but now it doesn't work on images on ... htmlcss adarsh dubey 350 asked aug 14, 2021 at 8:23","['html', 'css']",en,make image nonselectable css making html css website want put image people select drag earlier userselect none worked images texts work images htmlcss ndash due asked aug
337"how to pass environment variables in gitlab dynamically? i am working on database deployment using gitlab cicd. now there are two databases e.g. abc and xyz. one team is working on db abc and we are working on db xyz. now the logic is same but if we need to ... variablesautomationgitlabgitlab-cicicd laster 458 asked dec 27, 2022 at 17:00","['variables', 'automation', 'gitlab', 'gitlab-ci', 'cicd']",en,pass environment variables github dynamically working database deployment using github cid two databases eg abc xyz one team working db abc working db xyz logic need variablesautomationgitlabgitlabcivic later asked dec
338"spring @configurationproperties works wierd, maybe incorrect was working on configuration classes and spotted strange behavior. prepared small test to reproduce it: @slf4j @extendwith(springextension.class) @testpropertysource(""classpath:test.yml"") ... javaspringtestingdependency-injectionproperties 0xff 11 asked yesterday","['java', 'spring', 'testing', 'dependency-injection', 'properties']",en,spring configurationproperties works weird maybe incorrect working configuration classes spotted strange behavior prepared small test reproduce selfj extendwithspringextensionclass testpropertysourceclassmatetestml javaspringtestingdependencyinjectionproperties asked yesterday
339"how to join a slice of strings into a single string? package main import ( ""fmt"" ""strings"" ) func main() { reg := [...]string {""a"",""b"",""c""} fmt.println(strings.join(reg,"","")) } gives me an error of: prog.go:10: cannot use reg (type [3]string) as ... goslice cycle4passion 3,341 asked mar 1, 2015 at 21:09","['go', 'slice']",en,join slice strings single string package main import fmt strings func main reg string abc fmtprintstringsjoinreg gives error proggo cannot use reg type string police cyclepassion asked mar
340"reflection rookie question about getting field value i have a class that contains the field value that i'm trying to get, but it is failing to a ""nothing"" value. could you please give this rookie a hand? thanks in advance! m445_class_type.... vb.net michael sanders 41 asked mar 13, 2024 at 15:21",['vb.net'],en,reflection rookie question getting field value class contains field value trying get failing nothing value could please give rookie hand thanks advance mclasstype vbnet michael sanders asked mar
341"using isnull vs using coalesce for checking a specific condition? i know that multiple parameters can be passed to coalesce, but when you want to to check just one expression to see if it doesn't exist, do you use a default or is it a better practice to use isnull ... sqlt-sqlcoalesceisnull jbone 3,213 asked sep 13, 2011 at 21:40","['sql', 't-sql', 'coalesce', 'isnull']",en,using null vs using coalesce checking specific condition know multiple parameters passed coalesce want check one expression see exist use default better practice use null saltsqlcoalesceisnull bone asked sep
342"react-router does not work in production and surge deployments my react application is working fine on localhost but when after i deployed it in gh-pages or surge it does not give me to move among pages using url. this is the project repo link demo url here ... javascriptreactjsreact-routerreact-router-dom isuruab 2,240 asked jun 12, 2017 at 3:54","['javascript', 'reactjs', 'react-router', 'react-router-dom']",en,reactrouter work production surge deployments react application working fine localhost deployed ghpages surge give move among pages using url project repo link demo url javascriptreactjsreactrouterreactrouterdom isuruab asked jun
343"why am i getting a type mismatch on my symfony form using an entitytype when using handlerequest? in my application, i have a form generated using a class like so: public function buildform(formbuilderinterface $builder, array $options): void { $builder ->add('id', ... phpsymfonysymfony-forms steve weigold 33 asked 20 hours ago","['php', 'symfony', 'symfony-forms']",en,getting type mismatch symphony form using entitytype using handlerequest application form generated using class like public function buildformformbuilderinterface builder array options void builder addid phpsymfonysymfonyforms steve weighed asked hours ago
344"s3a class working on driver but not executor i have docker images created using spark 3.3.4 docker-image-tool.sh, using the supplied dockerfiles for the base and pyspark. running on eks 1.29 with latest spark-operator using base image i created ... apache-sparkkuberneteshadooppyspark mikejansen 3,486 asked mar 6, 2024 at 20:51","['apache-spark', 'kubernetes', 'hadoop', 'pyspark']",en,sa class working driver executor decker images created using spark deckerimagetoolsh using supplied dockerfiles base spark running es latest sparkoperator using base image created apachesparkkuberneteshadooppyspark mikejansen asked mar
345"websocket getting closed immediately after connecting to fastapi endpoint i'm trying to connect a websocket aiohttp client to a fastapi websocket endpoint, but i can't send or recieve any data because it seems that the websocket gets closed immediately after connecting to ... pythonpython-3.xwebsocketfastapiaiohttp 404kuso 192 asked mar 19, 2022 at 21:19","['python', 'python-3.x', 'websocket', 'fastapi', 'aiohttp']",en,websocket getting closed immediately connecting fastapi endpoint trying connect websocket aiohttp client fastapi websocket endpoint cannot send receive data seems websocket gets closed immediately connecting pythonpythonxwebsocketfastapiaiohttp kuo asked mar
346"how can identifiers like roles and tables be used dynamically in gorm with raw sql? i am working on a go project using gorm and postgresql, and i need to dynamically use identifiers such as roles and tables in my sql queries. however, i am encountering an issue with parameterized ... postgresqlgogo-gorm aaron newton 2,316 asked aug 8, 2024 at 5:23","['postgresql', 'go', 'go-gorm']",en,identifiers like roles tables used dynamically form raw sql working go project using form postgresql need dynamically use identifiers roles tables sql queries however encountering issue parameterized postgresqlgogoform aaron newton asked aug
347"react.js styled-components importing images and using them as div background i am using styled-components and am trying to set a background image like so const headerimage= styled.div` background-image: url('../../assets/image.png'); '; i've also tried without the quotes,... reactjsstyled-components vedran 1,153 asked dec 27, 2016 at 13:49","['reactjs', 'styled-components']",en,reactjs styledcomponents importing images using div background using styledcomponents trying set background image like const headerimage styleddiv backgroundimage urlassetsimagepng also tried without quotes reactjsstyledcomponents median asked dec
348"after installing oh-my-zsh on mac git branch don't show, but after .oh-my-zsh it works macos bigsur installed oh-my-zsh by sh -c ""$(curl -fssl https://raw.github.com/ohmyzsh/ohmyzsh/master/tools/install.sh)"" when i start terminal git branch don't show but after run .oh-my-zsh ... zshoh-my-zsh zubescu 51 asked nov 9, 2021 at 20:06","['zsh', 'oh-my-zsh']",en,installing ohmyzh mac git branch show ohmyzh works marcos bigger installed ohmyzh sh c curl ssl start terminal git branch show run ohmyzh showmyzh dulescu asked nov
349"web scraping wikipedia table using beautiful soup getting 'none' returned new to web scraping and coding in general. this is probably an easy problem for someone more experienced... maybe not... here it is: trying to web scrape a table from wikipedia. i've located the table ... pythonweb-scrapingbeautifulsoupwikipedia rar9000 45 asked mar 6, 2024 at 23:06","['python', 'web-scraping', 'beautifulsoup', 'wikipedia']",en,web scraping wikipedia table using beautiful soup getting none returned new web scraping coding general probably easy problem someone experienced maybe trying web scrape table wikipedia located table pythonwebscrapingbeautifulsoupwikipedia rar asked mar
350"trigger gitlab ci pipeline on merge my .gilab-ci.yml file contains this: deploy_to_prelive: artifacts: {} tags: - mytag stage: deploy script: - echo ""deploy"" environment: name: prelive url: https://... gitlab-ci titus 806 asked apr 25, 2024 at 14:17",['gitlab-ci'],en,trigger github ci pipeline merge labciml file contains deploytoprecise artifacts tags meta stage deploy script echo deploy environment name precise url githubci tits asked apr
351export multiple csv files from multiple tabs in google sheets i have a google sheet with multiple tabs. i would like to export each tab to an individual csv file with the name of the tab tabsexport john copley 1 asked 1 hour ago,"['tabs', 'export']",en,export multiple csv files multiple tabs google sheets google sheet multiple tabs would like export tab individual csv file name tab tabsexport john copy asked hour ago
352"golang: no required module provides package i created a new folder with main.go and with following code: package main import ( ""net/http"" ""github.com/gin-gonic/gin"" ) func main() { r := gin.default() r.get(... go zyros 135 asked jul 13, 2022 at 21:20",['go'],en,lang required module provides package created new folder maingo following code package main import nethttp githubcomginsonicgin func main gindefault rget go zeros asked jul
353"which culture code to use for chinese string resource (resx) files? we're planning to translate our wpf desktop application to simplified chinese but i've noticed two similar culture codes: zh-cn and zh-chs. what is the difference, and which resource file should we ... wpflocalizationtranslationcultureinfo andrew stephens 10.2k asked feb 5, 2024 at 13:36","['wpf', 'localization', 'translation', 'cultureinfo']",en,culture code use chinese string resource rest files planning translate wp desktop application simplified chinese noticed two similar culture codes zhcn zhchs difference resource file wpflocalizationtranslationcultureinfo andrew stephens k asked feb
354"upgrade angularjs to angular quickstart fails loading platformbrowserdynamic i need to upgrade an angularjs app to the latest angular so i'm using the angular upgrade guide, which instructs me to start with the quickstart repo provided by angular. angular upgrade guide - setup ... angularangularjssystemjs rudazzle 375 asked mar 4, 2024 at 14:16","['angular', 'angularjs', 'systemjs']",en,upgrade angular angular quickstart fails loading platformbrowserdynamic need upgrade angular app latest angular using angular upgrade guide instructs start quickstart repo provided angular angular upgrade guide setup angularangularjssystemjs rudazzle asked mar
355"how to make private function in javascript [closed] i want to make private function for my language interpreter . problem is with that i have some variables and functions i want not to be executed by the user for example function run1(){ alert(""1&... javascriptfunctionevalinterpreter ziomuśguy22500 1 asked 9 mins ago","['javascript', 'function', 'eval', 'interpreter']",en,make private function javascript closed want make private function language interpreter problem variables functions want executed user example function run alert javascriptfunctionevalinterpreter zoomsguy asked mins ago
356"""gradle task fails: could not get unknown property 'ssh'"" i'm trying to deploy my java web app using a custom gradle task with docker_deploy, but i get an error when running ./gradlew docker_deploy > could not get unknown property 'ssh' for task ':... gradlesshdeployment huynh thang 3 asked apr 17 at 18:36","['gradle', 'ssh', 'deployment']",en,grade task fails could get unknown property ssh trying deploy java web app using custom grade task deckerdeploy get error running grade deckerdeploy could get unknown property ssh task gradlesshdeployment hunt asked apr
357"flutter api delete 405 methot allowed i am having a problem with the working of the api. installing the api to iis executes ""405"". however, when running on localhost, it returns 200. i couldn't understand what should i do? i am ... flutterdart ahmet enes söylemez 41 asked mar 1, 2023 at 9:12","['flutter', 'dart']",en,clutter api delete method allowed problem working api installing api iis executes however running localhost returns could understand flutterdart ahmed ones soyemen asked mar
358"problem with internal error in the mapping procesor while using mapstruct it was my first attempt using gradle and i got some weird problem i never heard of. google didn't help me too much so i am humbly asking for some help. i started using mapstruct after i got some ... javaspringgradlemapstruct miedzic 61 asked aug 3, 2022 at 14:37","['java', 'spring', 'gradle', 'mapstruct']",en,problem internal error mapping processor using mapstruct first attempt using grade got weird problem never heard google help much humbly asking help started using mapstruct got javaspringgradlemapstruct medic asked aug
359"asset validation failed 90476 in flutter ive just got this error: asset validation failed 90476 the error is appearing in the mac transporter app. it's an app for ios and ipad os. the app builds like normal and it says that it's getting ... iosflutterxcode lucas knötig 122 asked jul 25, 2023 at 12:34","['ios', 'flutter', 'xcode']",en,asset validation failed clutter got error asset validation failed error appearing mac transporter app app ios ipad os app builds like normal says getting iosflutterxcode lucas knotig asked jul
360"how to add gitlab private repository in argocd i am facing one issue let's assume i have created a gitlab repository and added in argocd using crd with my username and password, how will other developers access or create a project or an ... argocd sumit 31 asked jan 30, 2023 at 8:19",['argocd'],en,add github private repository argued facing one issue let us assume created github repository added argued using crd username password developers access create project argued submit asked jan
361"video + audio+youtube player i'm looking for a comprehensive package that includes audio, video, and youtube player functionality from the cloud(not local). this package should be compatible with android, ios, and web platforms, ... angularionic-frameworkvideoyoutubecapacitor ejeck 41 asked aug 27, 2024 at 13:25","['angular', 'ionic-framework', 'video', 'youtube', 'capacitor']",en,video audioyoutube player looking comprehensive package includes audio video youtube player functionality cloudnot local package compatible android ios web platforms angularionicframeworkvideoyoutubecapacitor eject asked aug
362pgp public key exception i have a pgp public key in my azure key vault when i try to use it in my .net application am getting the below exception. system.argumentexception: 'passed in key not an encryption key!' stream ... .netazureazure-keyvaultpgp umashankar 19 asked 2 days ago,"['.net', 'azure', 'azure-keyvault', 'pgp']",en,pg public key exception pg public key azure key vault try use net application getting exception systemargumentexception passed key encryption key stream netazureazurekeyvaultpgp umashankar asked days ago
363"no module named ‘torchvision.models.utils‘ when i use the environment of pytorch=1.10.0, torchvision=0.11.1 to run the code, i run to the statement from torchvision.models.utils import load_state_dict_from_url. the following error will appear ... pythonpytorchtorchvision oscar rangel 1,096 asked feb 5, 2022 at 14:06","['python', 'pytorch', 'torchvision']",en,module named torchvisionmodelsuntil use environment pwtorch torchvision run code run statement torchvisionmodelsuntil import loadstatedictfromurl following error appear pythonpytorchtorchvision oscar range asked feb
364"simplify this regex to reduce its complexity sonarlint is currently yelling at me for the complexity of some regex i am using for tax id numbers. i need to reduce the complexity from 21 to 20 and i simply cannot think of a way to do that. all of ... javaregexsonarqubesonarlint scottyboombox 45 asked apr 6, 2023 at 14:33","['java', 'regex', 'sonarqube', 'sonarlint']",en,simplify regex reduce complexity sonarlint currently yelling complexity regex using tax id numbers need reduce complexity simply cannot think way javaregexsonarqubesonarlint scottyboombox asked apr
365"intellij idea global environment variable configuration i need to use an environment variable in all of my idea run configurations. i currently use run->edit configurations->and then enter the env variables in selected configuration. however, that's ... intellij-ideaenvironment-variablesintellij-plugin ben 4,308 asked aug 15, 2017 at 15:32","['intellij-idea', 'environment-variables', 'intellij-plugin']",en,intellij idea global environment variable configuration need use environment variable idea run configurations currently use runedit configurationsand enter env variables selected configuration however intellijideaenvironmentvariablesintellijplugin ben asked aug
366"why is there not an implementation of a linked list in javascript? for example java has both arraylist and linkedlist which behave as one would expect regarding big o. javascript has array [], which behaves like a dynamic array as you can insert and delete to it ... javascriptjavaarrayslinked-listbig-o user18924622 asked may 19, 2022 at 2:22","['javascript', 'java', 'arrays', 'linked-list', 'big-o']",en,implementation linked list javascript example java arraylist linkedlist behave one would expect regarding big javascript array behaves like dynamic array insert delete javascriptjavaarrayslinkedlistingo user asked may
367"how to shrink code - 65k method limit in dex i have a rather large android app that relies on many library projects. the android compiler has a limitation of 65536 methods per .dex file and i am surpassing that number. there are basically two ... androidgoogle-drive-apiguavadexandroid-multidex jared rummler 38.2k asked mar 18, 2013 at 7:34","['android', 'google-drive-api', 'guava', 'dex', 'android-multidex']",en,shrink code k method limit dex rather large android app relies many library projects android compiler limitation methods per dex file surpassing number basically two androidgoogledriveapiguavadexandroidmultiplex jared summer k asked mar
368"gmail is not receiving bulk emails from 1 specific email i am sending emails from an outlook account(noreply account for bulk emails) to gmail. but the emails are not being received by the gmail account although the same is received by any other email ... emailoutlookgmail michael benning 19 asked aug 24, 2023 at 11:18","['email', 'outlook', 'gmail']",en,gmail receiving bulk emails specific email sending emails outlook accountreply account bulk emails gmail emails received gmail account although received email emailoutlookgmail michael banning asked aug
369"how to create a azure service principal with more than one subscription at its scope using azure cli? basically the title. i want to create a service principal who has access to more than 1 subscription. i can create a service principal with access to one subscription as follows: az ad sp create-for-... azureazure-cli pritam barhate 775 asked may 11, 2023 at 17:01","['azure', 'azure-cli']",en,create azure service principal one subscription scope using azure cli basically title want create service principal access subscription create service principal access one subscription follows az ad sp createfor azureazurecli proteam karate asked may
370"best practice to use pyo3-polars with `group_by` i'm currently in the process of experimenting with pyo3-polars to optimize data aggregation. in a more abstract sense, what i have in mind is the following structure: df.group_by(c.col1).agg(c.col2.... python-polarsrust-polarspyo3 sungmin 2,631 asked nov 10, 2023 at 15:48","['python-polars', 'rust-polars', 'pyo3']",en,best practice use pyopolar groupby currently process experimenting pyopolar optimize data aggregation abstract sense mind following structure dfgroupbyccolaggccol pythonpolarsrustpolarspyo sungmin asked nov
371"unexpected copy in unpacking via structured bindings a returned tuple i'm trying to use structured bindings to return an std::tuple<std::string, std::vector<std::string_view>>, which represents a string and string-views pointing to the said string. ... c++c++17structured-bindings jerin 653 asked sep 25, 2023 at 17:36","['c++', 'c++17', 'structured-bindings']",en,unexpected copy packing via structured bindings returned title trying use structured bindings return stdtitle represents string stringviews pointing said string ccstructuredbindings erin asked sep
372"cannot connect to $(minikube ip):$node_port on mac m1 i am learning kubernetes on minikube. i studied the kubernetes official documentation and followed their interactive tutorial in a sandboxed environment. everything worked fine in the sandbox but i ... dockerkubernetesminikube prateik pokharel 73 asked apr 28, 2022 at 5:27","['docker', 'kubernetes', 'minikube']",en,cannot connect minikube ipnodeport mac learning kubernetes minikube studied kubernetes official documentation followed interactive tutorial sandboxes environment everything worked fine sandbox dockerkubernetesminikube protein pokharel asked apr
373"add a sub-column to multi-level dataframe my dataframe looks like first second a b a b 1 50 60 70 100 2 20 5 10 30 3 35 45 60 50 i want to add a new sub-column in each top-level column using .diff(), so ... pythonpandasdataframemultiple-columns yudosmootho 41 asked feb 19, 2024 at 22:24","['python', 'pandas', 'dataframe', 'multiple-columns']",en,add subcolumn multilevel dataframe dataframe looks like first second b b want add new subcolumn toplevel column using different pythonpandasdataframemultiplecolumns yudosmootho asked feb
374"cas 6.6.15 created service ticket results in invalid_service i am trying to upgrade our application to cas 6.6.15 from 5.3.16. in some scenarios, we create our own cas service tickets, which used to work without any problems. now, this results in ... cas chris rompot 1 asked may 1, 2024 at 14:34",['cas'],en,cas created service ticket results invalidservice trying upgrade application cas scenarios create cas service tickets used work without problems results cas chris robot asked may
375"the displayinfochanged event is triggered only randomly in .net maui public mainpage() { initializecomponent(); bindingcontext = new circlecolorsviewmodel(); devicedisplay.current.maindisplayinfochanged += current_maindisplayinfochanged; } public void ... .netevent-handlinglistenermauiscreen-orientation nevin sever 1 asked aug 16, 2023 at 19:43","['.net', 'event-handling', 'listener', 'maui', 'screen-orientation']",en,displayinfochanged event triggered randomly net mai public mainpage initializecomponent bindingcontext new circlecolorsviewmodel devicedisplaycurrentmaindisplayinfochanged currentmaindisplayinfochanged public void nexteventhandlinglistenermauiscreenorientation kevin sever asked aug
376"how to add custom theme to tailwind css besides dark and ligth i want to add a reader mode which is different from light and dark for example <div class=""text-white dark:text-black reader:text-yellow-100""><div> tailwind-csstailwind-in-jstailwind-variants revan99 446 asked nov 26, 2023 at 18:09","['tailwind-css', 'tailwind-in-js', 'tailwind-variants']",en,add custom theme tailwind css besides dark light want add reader mode different light dark example tailwindcsstailwindinjstailwindvariants evan asked nov
377"which html5 tag should i use to mark up an author’s name? for example of a blog-post or article. <article> <h1>header<h1> <time>09-02-2011</time> <author>john</author> my article.... </article> the author tag ... htmltagsblogssemantic-markup quang van 12.1k asked sep 3, 2011 at 1:03","['html', 'tags', 'blogs', 'semantic-markup']",en,html tag use mark authors name example blogpost article header john article author tag htmltagsblogssemanticmarkup quant van k asked sep
378"creating an asp.net app with crud functionatility but not able to create new products as the modelstate.isvalid is false i am writing an asp.net mvc web app with crud functionalities and my modelstate.isvalid is always returning false when i click on the create button. when i added some debugging, it shows that the drop ... c#.netasp.net-mvcasp.net-coreentity-framework-core jashman 1 asked feb 21, 2024 at 4:53","['c#', '.net', 'asp.net-mvc', 'asp.net-core', 'entity-framework-core']",en,creating aspnet app crude functionality able create new products modelstateinvalid false writing aspnet mvc web app crude functionalities modelstateinvalid always returning false click create button added debugging shows drop cnetsnetmvcaspnetcoreentityframeworkcore baseman asked feb
379"react-svg-radar-chart caption is partially displayed i am using below npm package npm i react-svg-radar-chart the chart is used to show the scores of some entities in different areas. the text provided to this which is a label or caption for that ... reactjssvgradar-chart esha varma 57 asked feb 1, 2024 at 7:47","['reactjs', 'svg', 'radar-chart']",en,reactsvgradarchart caption partially displayed using num package num reactsvgradarchart chart used show scores entities different areas text provided label caption reactjssvgradarchart sha karma asked feb
380"get slug to update when attribute of association changes i have attraction and venue models. their associations are: attraction belongs_to :venue venue has_many :attractions, dependent: :nullify i'm using the friendly_id gem to add slugs to both. they ... ruby-on-railsassociationsslugfriendly-id rctneil 7,220 asked jul 31, 2024 at 17:37","['ruby-on-rails', 'associations', 'slug', 'friendly-id']",en,get slug update attribute association changes attraction venue models associations attraction belongsto venue venue hasmany attractions dependent qualify using friendlyid gem add slugs rubyonrailsassociationsslugfriendlyid rctneil asked jul
381"error: use of moved value, while it cannot be used consider the following code: fn print_or(opt: option<()>, tail: vec<i32>) -> vec<i32> { opt.map_or(tail, |_| { println!(""{:?}"", tail); tail }) } ... rustmove-semanticsownership some name 9,570 asked may 31, 2024 at 5:24","['rust', 'move-semantics', 'ownership']",en,error use moved value cannot used consider following code fn printoropt option tail vec vec optmaportail print tail tail rustmovesemanticsownership name asked may
382"how to fix an unsatisfiedlinkerror (can't find dependent libraries) in a jni project i'm working on a java project that uses the jni. the jni calls a custom library that i've written myself, let's say mylib.dll, and that depends on a 3rd party library, libsndfile-1.dll. when i run ... javawindows-xpjava-native-interfacelibsndfile db' 8,350 asked may 23, 2011 at 2:14","['java', 'windows-xp', 'java-native-interface', 'libsndfile']",en,fix unsatisfiedlinkerror cannot find dependent libraries jni project working java project uses jni jni calls custom library written let us say mlball depends rd party library libsndfileall run javawindowsjavanativeinterfacelibsndfile db asked may
383"what's the in clause for this query? i'm new to data analytics and i'm trying to study subqueries. the lecture is asking to pull up all the number of hospitalizations using the fda events data from the bigquery public data. i tried to ... google-bigquerysubquery jopatsky 11 asked may 10, 2024 at 16:29","['google-bigquery', 'subquery']",en,clause query new data analytics trying study subqueries lecture asking pull number hospitalization using fda events data bdquery public data tried googlebigquerysubquery jopatsky asked may
384"jest tests failing with typeerror: (0 , _auth(...).getreactnativepersistence) is not a function on expo 49 similar to the question from here, i have upgraded to expo 49 and now some of my jest tests are failing with the following error: typeerror: (0 , _auth(...).getreactnativepersistence) is not a ... firebasereact-nativejestjsexpo shawn 531 asked sep 29, 2023 at 16:49","['firebase', 'react-native', 'jestjs', 'expo']",en,jest tests failing typeerror authgetreactnativepersistence function expo similar question upgraded expo jest tests failing following error typeerror authgetreactnativepersistence firebasereactnativejestjsexpo shawn asked sep
385"drawing closed polygons from simple lines i am trying to create a program that allows users to draw different types of shapes by drawing simple lines using pyqt5. the program must detect if a shape is closed and then automatically fill the ... pythonpython-3.xuser-interfacepyqt5 ahoora 13 asked dec 30, 2023 at 19:51","['python', 'python-3.x', 'user-interface', 'pyqt5']",en,drawing closed polygons simple lines trying create program allows users draw different types shapes drawing simple lines using part program must detect shape closed automatically fill pythonpythonuserinterfacepyqt ahora asked dec
386"ssd1306 oled screen on esp32 using arduino ide i am trying to use an ssd1306 oled screen with an esp32 wroom on the arduino ide. i have installed the adafruit ssd1306 library along with the adafruit gfx libary, however i can't seem to get the ... esp32arduino-esp32 azza1402 1 asked nov 18, 2023 at 10:39","['esp32', 'arduino-esp32']",en,ssd old screen esp using arguing ide trying use ssd old screen esp room arguing ide installed adafruit ssd library along adafruit gfx library however cannot seem get esparguingesp aza asked nov
387"logging into saml/shibboleth authenticated server using python i'm trying to login my university's server via python, but i'm entirely unsure of how to go about generating the appropriate http posts, creating the keys and certificates, and other parts of the ... pythonauthenticationsamlsaml-2.0shibboleth david perlaza 620 asked may 12, 2013 at 23:11","['python', 'authentication', 'saml', 'saml-2.0', 'shibboleth']",en,logging sameshibboleth authenticated server using python trying login universitys server via python entirely unsure go generating appropriate http posts creating keys certificates parts pythonauthenticationsamlsamlshibboleth david plaza asked may
388"custom ""navigate up"" behavior for certain fragment using navigation component i want to add custom up navigation from fragment using navigation component in my build.gradle(app) i use androidx.appcompat:appcompat:1.1.0-alpha04 dependency to have access to ... androidandroid-fragmentskotlinandroid-architecture-navigation roko spark 625 asked apr 29, 2019 at 13:31","['android', 'android-fragments', 'kotlin', 'android-architecture-navigation']",en,custom navigate behavior certain fragment using navigation component want add custom navigation fragment using navigation component buildgradeapp use androidappcompatappcompatalpha dependency access androidandroidfragmentskotlinandroidarchitecturenavigation rok spark asked apr
389"what's the idiomatic way of assigning a nullable variable to 2 different blocks? i thought the let and elvis operator would take care of nullable another way it seems to. in my above example, i want to check for a for being not null and returnsomethingnullable or in case a is null ... kotlinidioms pipo 5,113 asked yesterday","['kotlin', 'idioms']",en,idiomatic way assigning syllable variable different blocks thought let elvis operator would take care syllable another way seems example want check null returnsomethingnullable case null kotlinidioms pipe asked yesterday
390"run angular universal dev:ssr and choose the environment is it possible to run npm run dev:ssr and give it an environment flag? e.g.: npm run dev:ssr -c local? i would like to run an environment named ""local"" when i am running on my localhost. the ... angularangular-universal miss henesy 123 asked jan 25, 2023 at 22:26","['angular', 'angular-universal']",en,run angular universal devssr choose environment possible run num run devssr give environment flag eg num run devssr c local would like run environment named local running localhost angularangularuniversal miss heresy asked jan
391"how to use instance ids from the ec2 module into another resource in terraform? i am trying to create multiple ec2-instances using the terraform registry module, https://github.com/terraform-aws-modules/terraform-aws-ec2-instance here is my code looks like, ** main.tf ** locals ... amazon-web-servicesamazon-ec2terraformterraform-provider-aws saurabh 23 asked jul 12, 2023 at 11:19","['amazon-web-services', 'amazon-ec2', 'terraform', 'terraform-provider-aws']",en,use instance ids ec module another resource terraform trying create multiple ecinstances using terraform registry module code looks like maintf locals amazonwebservicesamazonecterraformterraformprovideraws sarah asked jul
392"how to put custom next and prev scroll buttons for div react i have two buttons. prev and next button. on below, i have one horizontal div with multiple items with scroll bar. here's the ui looks like: the scroll bar working good. but i have prev and next ... javascripthtmlcssreactjs bovop4 244 asked nov 14, 2022 at 6:17","['javascript', 'html', 'css', 'reactjs']",en,put custom next prev scroll buttons div react two buttons prev next button one horizontal div multiple items scroll bar ui looks like scroll bar working good prev next javascripthtmlcssreactjs book asked nov
393"french special characters unicode required for first name [duplicate] in the project that i am working on i want to add enhancement feature where user can add their french name in the first name field. i want to include all the special characters for french right now in ... javascriptunicodewcs arundhati 99 21 asked mar 19, 2024 at 6:52","['javascript', 'unicode', 'wcs']",en,french special characters unicode required first name duplicate project working want add enhancement feature user add french name first name field want include special characters french right javascriptunicodewcs arundhati asked mar
394"rendering of cloze questions in pdf with r/exams i am trying to use r/exams to produce questions in pdf for a written exam. i would like that ##answern## in cloze questions is rendered in the pdf file, as follows: a num question with a space: the ... r-exams massimo2013 593 asked feb 20, 2024 at 11:05",['r-exams'],en,rendering close questions pdf rexams trying use rexams produce questions pdf written exam would like answer close questions rendered pdf file follows num question space rexams massive asked feb
395"how to open parquet files in a gzip format in a zip archive as a pandas dataframe in python without first extracting it? i have a series of zip files containing parquet files that are in a gzip format. i am trying to open the parquet files in pandas without extracting the whole archive first. from the python zipfile ... pythonpandaszipgzipparquet mrkingsley 202 asked jul 17, 2023 at 15:12","['python', 'pandas', 'zip', 'gzip', 'parquet']",en,open parque files grip format zip archive panda dataframe python without first extracting series zip files containing parque files grip format trying open parque files panda without extracting whole archive first python zipfile pythonpandaszipgzipparquet mrkingsley asked jul
396"spyder tkinter buttons require multiple clicks before execution i'm new to python and currently working on a password generator program using the spyder ide with tkinter. i'm encountering an issue where, especially after the first run, clicking any button in my ... pythonuser-interfacetkinterbuttonspyder gary l 11 asked jan 19, 2024 at 0:49","['python', 'user-interface', 'tkinter', 'button', 'spyder']",en,spider painter buttons require multiple clicks execution new python currently working password generator program using spider ide painter encountering issue especially first run clicking button pythonuserinterfacetkinterbuttonspyder gary l asked jan
397"docker container ""cannot find module 'randomstring'"" with node i am trying to run a docker container from an image created from the dockerfile below i run this command to create the image: docker build -t myimage . i run this command to start the container: ... node.jsdockernpmdockerfile tom weisner 23 asked mar 20, 2024 at 16:25","['node.js', 'docker', 'npm', 'dockerfile']",en,decker container cannot find module randomstring node trying run decker container image created dockerfile run command create image decker build image run command start container nodejsdockernpmdockerfile tom winner asked mar
398"expo react native onpress navigation.opendrawer() not working. thank you in advance for your support i am unable to open the drawer by pressing the header button, i tried many times but i failed to solve the issue. here below is the issue i am getting- menu.js:65 uncaught typeerror: navigation.... reactjsreact-nativeexponavigation-drawer rainul hassan 61 asked jun 27, 2022 at 8:55","['reactjs', 'react-native', 'expo', 'navigation-drawer']",en,expo react native press navigationopendrawer working thank advance support unable open drawer pressing header button tried many times failed solve issue issue getting menujs caught typeerror navigation reactjsreactnativeexponavigationdrawer rail hassan asked jun
399"error ""permission denied for set_config"" in pgadmin i am attempting to setup a read-only user for my postgres db. i set the user to be a member of the predefined ""pg_read_all_data"" role, however when i try to connect to the db from pgadmin i ... databasepostgresql collin blomberg 31 asked 2 days ago","['database', 'postgresql']",en,error permission denied setconfig admin attempting setup readonly user posters db set user member predefined pgreadalldata role however try connect db admin databasepostgresql collins bloomberg asked days ago
400"is there a command in vim/vi to move the cursor to the end of a search highlight? are there any commands in vim/vi to move within a selected search segment? for instance, if i search for a word, are there any commands to motion the cursor to the end of the highlighted segment? ... vimvi jordan parmer 37.3k asked may 22, 2012 at 18:10","['vim', 'vi']",en,command himvi move cursor end search highlight commands himvi move within selected search segment instance search word commands motion cursor end highlighted segment vimeo jordan farmer k asked may
401"python django modelviewset implementation with saml acs in the current system with the legacy iam, we have implemented a class inherited from modelviewset with login and logout functions. in the legacy iam, it is not compulsory to obtain name_id and ... pythondjangosamldjango-saml2-auth chesschi 708 asked apr 1, 2024 at 18:41","['python', 'django', 'saml', 'django-saml2-auth']",en,python tango modelviewset implementation acs current system legacy iam implemented class inherited modelviewset login logo functions legacy iam compulsory obtain nameid pythondjangosamldjangosameauth chesschi asked apr
402"flutter background service doesn't work in release mode as i wrote in title, my background service doesn't work in release mode, still it works in debug mode. this is my code. this is very simple foreground task code, added in flutter counter example code. ... flutter mark_seo 41 asked jul 28, 2023 at 7:40",['flutter'],en,clutter background service work release mode wrote title background service work release mode still works debug mode code simple foreground task code added clutter counter example code clutter markseo asked jul
403"i need to control in open and close of sliderdrawer [duplicate] i need to control in open and close of sliderdrawer in flutter web application iam trying to control in open and close of sliderdrawer in flutter web application if ypu can help me in this leave your ... flutterdart mohamed gamal 3 asked feb 13, 2024 at 12:47","['flutter', 'dart']",en,need control open close sliderdrawer duplicate need control open close sliderdrawer clutter web application iam trying control open close sliderdrawer clutter web application help leave flutterdart mohamed kamal asked feb
404"dto constructors when nullable reference type enabled [closed] some scenarios in my code is that i have to get an object from an external service, deserialize it and return it to the front end. my code includes nullable reference from c# 8 and compiler complains ... c#oopnullable-reference-types pasha 33 asked sep 30, 2023 at 14:49","['c#', 'oop', 'nullable-reference-types']",en,constructors syllable reference type enabled closed scenarios code get object external service deserialize return front end code includes syllable reference c compiler complains coopnullablereferencetypes pasta asked sep
405"date and time setting in django (24h clock) my django (5) instance adds am and pm to times, but here we are used to 24h clocks. so i wish to change this behavior. in my model i have this field: added_date = models.datetimefield(""date added&... djangodatetime freek 1,199 asked yesterday","['django', 'datetime']",en,date time setting tango h clock tango instance adds pm times used h clocks wish change behavior model field addeddate modelsdatetimefielddate added djangodatetime free asked yesterday
406"this code can be a hook system function in 5.15.0-73, but it is invalid at 5.15.0-113 i am searching for a long time on net. but no use. please help or try to give some ideas how to achieve this in the 5.15.0-113, 5.15.0-119 kernel, try the information of the hook system calling table ... linux luckybacon 1 asked sep 4, 2024 at 9:56",['linux'],en,code hook system function invalid searching long time net use please help try give ideas achieve kernel try information hook system calling table linux luckybacon asked sep
407"authorize.net api to charge credit card taking over 20 seconds this has been an issue for a few months now. authorize.net claims that the bottleneck is not on their end. i get the same slow response from our production server as well as when i run locally in my ... asp.net-mvcperformanceasp.net-coreauthorize.net paul marangoni 97 asked nov 15, 2023 at 23:42","['asp.net-mvc', 'performance', 'asp.net-core', 'authorize.net']",en,authorizenet api charge credit card taking seconds issue months authorizenet claims bottleneck end get slow response production server well run locally aspnetmvcperformanceaspnetcoreauthorizenet paul marangoni asked nov
408"java number of threads in parallel streams in kubernetes i have a java service deployed in kubernetes, and it uses parallel streams for concurrent processing. i read that the number of threads that spawed is being determined by the number of cores that the ... javamultithreadingkubernetes pavlmits 573 asked jun 28, 2023 at 15:57","['java', 'multithreading', 'kubernetes']",en,java number threads parallel streams kubernetes java service deployed kubernetes uses parallel streams concurrent processing read number threads spawned determined number cores javamultithreadingkubernetes pavlmits asked jun
409"import a local xls to google sheets with apps script i want to automatically import an xls file that i save to a specified local folder on a laptop weekly to a google sheets. i want to replace the data in a sheet each time the import is done. the file ... excelgoogle-apps-scriptgoogle-sheetsimport-from-excel martin robertson 1 asked dec 6, 2022 at 12:51","['excel', 'google-apps-script', 'google-sheets', 'import-from-excel']",en,import local xls google sheets apps script want automatically import xls file save specified local folder laptop weekly google sheets want replace data sheet time import done file excelgoogleappsscriptgooglesheetsimportfromexcel martin robertson asked dec
410"im curious how array indexing works here because this works but im confused why public polynomial add(polynomial other){ int max = math.max(coefficients.length, other.coefficients.length); int[] newpoly = new int[max]; for (int i=0; i<max; i++){ if (i<coefficients.... javaarraysindexingaddition suleman dawood 1 asked apr 2, 2024 at 15:53","['java', 'arrays', 'indexing', 'addition']",en,curious array indexing works works confused public polynomial addpolynomial int max mathmaxcoefficientslength othercoefficientslength int newly new intmax int imax icoefficients javaarraysindexingaddition sultan wood asked apr
411"how to checkout specific sub directory from gitlab repository my gitlab repo size is 20gb. i need to checkout only a specific sub directory from the gitlab repo. how i can do this. i do not want to clone the entire 20g gitlab repo as i just want to work on a ... gitlab niraj pandey 72 asked mar 7, 2024 at 10:12",['gitlab'],en,checkout specific sub directory github repository github repo size gb need checkout specific sub directory github repo want clone entire g github repo want work github nica handed asked mar
412"i am not able to navigate to another page. error message being shown is caller doesn't have the permission to execute specified operation rules_version = '2'; service cloud.firestore { match /databases/{database}/documents { match /{document=**} { allow read, write } } } import 'package:cloud_firestore/cloud_firestore.... androidfluttergoogle-cloud-firestorefirebase-security dhrumil rupapara 1 asked mar 4, 2024 at 11:57","['android', 'flutter', 'google-cloud-firestore', 'firebase-security']",en,able navigate another page error message shown caller permission execute specified operation rulesversion service cloudrestore match databasesdatabasedocuments match document allow read write import packagecloudrestorecloudrestore androidfluttergooglecloudfirestorefirebasesecurity dhrumil rupapara asked mar
413"facing error in printing the number of vowels .model small .stack 100h .data msg db ? msg2 db ? vowel_count db 0 .code main proc mov ax, @data mov ds, ax mov si, offset msg mov ah, 1 input: int 21h cmp al, 0dh je ... stringassemblyx86counter arham malik 1 asked oct 28, 2023 at 14:50","['string', 'assembly', 'x86', 'counter']",en,facing error printing number vowels model small stack h data message db msg db vowelcount db code main proc mov ax data mov ds ax mov si offset message mov ah input int h cmp al dh je stringassemblyxcounter area malik asked oct
414"using pip in a venv for running under pypy? this question is to disambiguate a similar yet slightly different one in the way that they fan-out to sub-questions, so i do expect some duplicate votes in the spirit of voting duplicate on anything ... numpypippython-venvpypy matanox 13.8k asked feb 4, 2024 at 14:12","['numpy', 'pip', 'python-venv', 'pypy']",en,using pip vent running type question disambiguate similar yet slightly different one way fanout subquestions expect duplicate votes spirit voting duplicate anything numpypippythonvenvpypy matanox k asked feb
415"prop is not reactive when passed down in render function reproducer: https://stackblitz.com/edit/vue-tjt1qp?file=src/components/parentcomponent.js in the reproducer above, i expect the child to behave in the same way as the parent. i am trying to pass props ... vuejs3vue-render-function tom 386 asked feb 8, 2023 at 13:43","['vuejs3', 'vue-render-function']",en,prop reactive passed render function reproduced reproduced expect child behave way parent trying pass props viewsvuerenderfunction tom asked feb
416"sequelize - adding a limit to a query with an include, fails to properly limit retrievals issue description adding a limit to a sequelize query with a subquery fails to limit retrievals. multiple online resources referencing this error and no solutions. is this a sequelize error or user ... mysqlnode.jssequelize.jsserverless-framework speros 381 asked may 12, 2020 at 21:17","['mysql', 'node.js', 'sequelize.js', 'serverless-framework']",en,sequelize adding limit query include fails properly limit retrieval issue description adding limit sequelize query subquery fails limit retrieval multiple online resources referencing error solutions sequelize error user mysqlnodejssequelizejsserverlessframework sports asked may
417"stripe payments requires bearer header but i put it and it's not working i made a react app and i have some payments integrated. in test mode i'm trying to submit a payment but i always get the authenticate error error stripeauthenticationerror: you did not provide an api ... reactjsstripe-payments calin onaca 57 asked mar 15, 2023 at 20:33","['reactjs', 'stripe-payments']",en,stripe payments requires bearer header put working made react app payments integrated test mode trying submit payment always get authenticate error error stripeauthenticationerror provide api reactjsstripepayments cabin asked mar
418"how running old tensorflow 1.x / tf1.x code? sometimes, i'm facing problem running old tensorflow 1.x code. what are the strategies? tensorflow claude coulombe 3,748 asked nov 30, 2022 at 7:50",['tensorflow'],en,running old tensorflow x tfx code sometimes facing problem running old tensorflow x code strategies tensorflow claude coulombe asked nov
419"get-mgdevicemanagementvirtualendpointcloudpc not working i used can run this but don't know why it's not working now. error message: get-mgdevicemanagementvirtualendpointcloudpc : the term '
get-mgdevicemanagementvirtualendpointcloudpc
' is not ... azurepowershell xu tower 1 asked aug 17, 2023 at 2:47","['azure', 'powershell']",en,getmgdevicemanagementvirtualendpointcloudpc working used run know working error message getmgdevicemanagementvirtualendpointcloudpc term getmgdevicemanagementvirtualendpointcloudpc azurepowershell xu tower asked aug
420"sidebar with vertical scroll that contains drag and drop items that are not visible outside i have a sidebar with some divs that overflow the height and so vertical scrollbar is needed. the problem it's that these divs can be drag and dropped outside the sidebar. so the sidebar must have the ... cssdrag-and-dropoverflowinteractjs marcotw 113 asked sep 9, 2024 at 15:42","['css', 'drag-and-drop', 'overflow', 'interactjs']",en,sidebar vertical scroll contains drag drop items visible outside sidebar div overflow height vertical scrollbar needed problem div drag dropped outside sidebar sidebar must cssdraganddropoverflowinteractjs mascot asked sep
421"gsap scrolltrigger || the animation happen when i scroll back but not working (can't see the carousel at all) when i scroll down i am trying to create a rounded carousel with scroll using gsap scrolltrigger , i add a section that have 300vh height and in it a parallax section that contain a morphing from wave svg to a half of ... reactjsanimationgsapscrolltrigger razan tuhaimer 1 asked aug 30, 2024 at 19:37","['reactjs', 'animation', 'gsap', 'scrolltrigger']",en,gap scrolltrigger animation happen scroll back working cannot see carousel scroll trying create rounded carousel scroll using gap scrolltrigger add section vh height parallax section contain morphine wave svg half reactjsanimationgsapscrolltrigger kazan tuhaimer asked aug
422"warning in install.packages : unable to access index for repository http://mran.revolutionanalytics.com i downloaded microsoft r open 3.2.2 i need to install ggplot2 but if i run install.packages(""ggplot2"") from rstudio i receive the error: warning in install.packages : unable to access ... rggplot2 francesco mantovani 12.4k asked feb 5, 2024 at 11:28","['r', 'ggplot2']",en,warning installpackages unable access index repository httpmanrevolutionanalyticscom downloaded microsoft r open need install plot run installpackagesplot studio receive error warning installpackages unable access rggplot francesco mantovani k asked feb
423"extracting gps coordinates from image using python code: from pil import image from pil.exiftags import tags # path to the image or video imagename = ""image.jpg"" # read the image data using pil image = image.open(imagename) # extract exif ... pythongeolocationexif srini 21 asked sep 29, 2020 at 5:58","['python', 'geolocation', 'exif']",en,extracting gps coordinates image using python code pil import image pilexiftags import tags path image video pagename imagejpg read image data using pil image imageopenpagename extract exit pythongeolocationexif bring asked sep
424"laravel linkedin api 401 error organisation post data i've created a linkedin account to retrieve organization post data. i was able to successfully obtain an oauth access token. however, when i try to access user data using the endpoint: get https://api.... laravellinkedin-api sushil katoch 11 asked apr 21 at 6:40","['laravel', 'linkedin-api']",en,travel linkedin api error organisation post data created linkedin account retrieve organization post data able successfully obtain oath access token however try access user data using endpoint get laravellinkedinapi sushi match asked apr
425"linkace installation problems on server (without docker) i'm trying install linkace (bookmark manager app) on my webserver. but nothing happens on my screen :( there is the installation guide i followed : https://www.linkace.org/docs/v1/setup/setup-without-... php.htaccesswebservercpanelself-hosting albertov 161 asked jul 23, 2023 at 15:31","['php', '.htaccess', 'webserver', 'cpanel', 'self-hosting']",en,linkage installation problems server without decker trying install linkage bookmark manager app observer nothing happens screen installation guide followed phphtaccesswebservercpanelselfhosting alberto asked jul
426"mergingtwo sql queries select and count in single statement i am working on project, where i am using two queries to get the result i wanted to process. query 1 select mid from pms.machine where status=1 and mid !=0; query 2 select mid,count(status) as queue ... sqlmysqlselectcountsql-update asarudin a 395 asked jul 25, 2024 at 19:10","['sql', 'mysql', 'select', 'count', 'sql-update']",en,mergingtwo sql queries select count single statement working project using two queries get result wanted process query select mid pmsmachine status mid query select midcountstatus queue sqlmysqlselectcountsqlupdate asarudin asked jul
427what constructors must be defined to satisfy copy constructible concept for any-like class? i would like to make a class that satisfies std::copy_constructible concept and in addition can be constructed from an arbitrary copy constructible value much like std::any does: #include <concepts&... c++constructorlanguage-lawyerc++20c++-concepts fedor 22.2k asked 2 days ago,"['c++', 'constructor', 'language-lawyer', 'c++20', 'c++-concepts']",en,constructors must defined satisfy copy constructive concept anylike class would like make class satisfies stdcopyconstructive concept addition constructed arbitrary copy constructive value much like stdany include concepts cconstructorlanguagelawyercconcepts k asked days ago
428"reference value returns null after initialization pinia vue3 i have the following code: import {usebasestore} from ""@/stores/usebasestore.js""; import {usebalancestore} from ""@/stores/usebalancestore.js""; const props = defineprops({ '... vuejs3inertiajspinia ivar 99 asked feb 3, 2024 at 20:02","['vuejs3', 'inertiajs', 'pinia']",en,reference value returns null initialization india vue following code import usebasestore storesusebasestorejs import usebalancestore storesusebalancestorejs const props defineprops viewsinertiajspinia var asked feb
429"failed to fetch fcm registration token on the vr headset in unity i encountered an error while trying to fetch the fcm registration token for my vr headset. the error message is: fetching fcm registration token failed com.google.firebase.messaging.firebasemessaging.... firebaseunity-game-enginepush-notificationfirebase-cloud-messaging raja saad 454 asked may 15, 2024 at 12:25","['firebase', 'unity-game-engine', 'push-notification', 'firebase-cloud-messaging']",en,failed fetch cm registration token vr headset unity encountered error trying fetch cm registration token vr headset error message etching cm registration token failed comgooglefishbasemessagingfirebasemessaging firebaseunitygameenginepushnotificationfirebasecloudmessaging raja said asked may
430"jsonwebtokenerror: jwt must be provided"" when using jwt for authentication in express.js description: i am building a web application using express.js for the backend and react for the frontend. i am implementing user authentication using json web tokens (jwt). however, i am encountering ... node.jsreactjsexpressjwtexpress-jwt sarthak 127 asked jul 23, 2023 at 12:16","['node.js', 'reactjs', 'express', 'jwt', 'express-jwt']",en,jsonwebtokenerror jet must provided using jet authentication expressjs description building web application using expressjs backend react frontend implementing user authentication using son web tokens jet however encountering nodejsreactjsexpressjwtexpressjet martha asked jul
431"how can i make block like this? [closed] hi all, i'm trying to recreate a visual layout similar to the one in the attached screenshot. it consists of several concentric ellipses with logos (images) placed neatly inside each ellipse. here's a ... htmlcssfrontendastrojs riverain 21 asked 7 hours ago","['html', 'css', 'frontend', 'astrojs']",en,make block like closed hi trying recreate visual layout similar one attached screenshot consists several concentric eclipses logos images placed neatly inside ellipse htmlcssfrontendastrojs rivera asked hours ago
432"how to map variable number of nested objects in object mapper with swift i have a json response (below) and i need to parse this - [ { ""id"":123, ""name"":""fahim rahman"", ""age"":25, ""friends"":[ { ... iosswiftobjectmapper mefahimrahman 349 asked nov 1, 2022 at 5:00","['ios', 'swift', 'objectmapper']",en,map variable number nested objects object rapper swift son response need parse id namehim rahman age friends iosswiftobjectmapper mefahimrahman asked nov
433"esp32-c3 1mhz timer not functioning in the below timer configuration examples for the arduino esp32-c3 core both should start a 1mhz timer (to multiplex a display) however if the first example is used (prescaler 80, interval 1) the chip ... arduinoesp32arduino-esp32 user54057 3 asked sep 26, 2023 at 0:55","['arduino', 'esp32', 'arduino-esp32']",en,espc mhz timer functioning timer configuration examples arguing espc core start mhz timer multiplex display however first example used prescaler interval chip arduinoesparguingesp user asked sep
434"different warning levels (though target_compile_options) for static library subproject in cmake [duplicate] i have a cmakelists.txt like this: project(myproject) add_subdirectory(somelibrary) add_executable(myproject ${src_files}) target_compile_options(myproject private -werror -wall) target_link_libraries(... c++cmake stkoverflowsellsurdatatoopenai 67 asked may 31, 2023 at 13:31","['c++', 'cmake']",en,different warning levels though targetcompileoptions static library subproject make duplicate cmakeliststxt like projectproject addsubdirectorysomelibrary addexecutableproject srcfiles targetcompileoptionsproject private error wall targetlinklibraries cmake stkoverflowsellsurdatatoopenai asked may
435"react _blank page just before redirecting to actuall page first time on stackoverflow asking question :) did somebody had a problem when using to redirect to new window(tab) in browser when we click on it, you very shortly see blank page just before ... reactjs strayder 1 asked jun 18, 2024 at 5:44",['reactjs'],en,react blank page redirecting actually page first time stackoverflow asking question somebody problem using redirect new windowtab browser click shortly see blank page reacts stranded asked jun
436"jakarta.xml.bind.unmarshalexception: unexpected element (uri:"""", local:""bizdata"") i am seeing error while un marshalling xml. i have xml with below tag but class name is different from jaxb class. expected elements are <{urn:iso:std:iso:20022:tech:xsd:head.001.001.02}apphdr>,&... unmarshalling sree 1 asked nov 22, 2023 at 15:18",['unmarshalling'],en,jakartaxmlbindunmarshalexception unexpected element uri localbiodata seeing error un marshalling xml xml tag class name different jab class expected elements marshalling free asked nov
437"template friendly string to numeric in c++ in c++ standard library there are functions to convert from string to numeric types: stoi stol stoll stoul stoull stof stod stold but i find it tedious to use them in template code. why there are no ... c++string-conversion mircea ispas 20.9k asked feb 19, 2020 at 13:45","['c++', 'string-conversion']",en,template friendly string numeric c c standard library functions convert string numeric types stop stop still soul stop stop sold find tedious use template code cstringconversion circa spas k asked feb
438"i am not able to getselection() in usevuequill i am trying to get the cursor coordinates to be able to add some text but when i am trying to use getselection i got this error : uncaught (in promise) typeerror: cannot read properties of null (... vue.jsvuejs3vue-quill-editor simpledev 414 asked oct 5, 2023 at 12:33","['vue.js', 'vuejs3', 'vue-quill-editor']",en,able getselection usevuequill trying get cursor coordinates able add text trying use getselection got error caught promise typeerror cannot read properties null vuejsvuejsvuequelleditor simpledev asked oct
439"obtain .exe path (or similar static identifier) of a windows program visible to user at a specific display coordinate i'm working on a small program that lets the user select a specific area of their screen by clicking their mouse and then throughout its run records what windows were visible to the user at that ... pythonwindowsprocess pomacanthidae 207 asked may 5, 2024 at 8:24","['python', 'windows', 'process']",en,obtain exe path similar static identifier windows program visible user specific display coordinate working small program let us user select specific area screen clicking mouse throughout run records windows visible user pythonwindowsprocess pomacanthidae asked may
440"how can i design a ui state class in viewmodel when i use android jetpack compose? i hope to design ui state class inside viewmodel to launch ui recomposition when a state changed. i have read some sample projects such as https://github.com/android/compose-samples and https://... androidkotlinandroid-jetpack-compose hellocw 2,475 asked jun 6, 2023 at 9:06","['android', 'kotlin', 'android-jetpack-compose']",en,design ui state class viewmodel use android setback compose hope design ui state class inside viewmodel launch ui decomposition state changed read sample projects androidkotlinandroidsetbackcompose yellow asked jun
441"when i use multiple imageinput，errors happened [closed] my code: inputele = [ak.imageinput(name='n1'),ak.imageinput(name='n2'), ak.imageinput(name='n3'),ak.imageinput(name='n4')] outputele = [ak.classificationhead(name='n7')] am =... kerasautomlkeras-tunerauto-keras user30348744 1 asked yesterday","['keras', 'automl', 'keras-tuner', 'auto-keras']",en,use multiple imageinputerrors happened closed code inputele akimageinputnamenakimageinputnamen akimageinputnamenakimageinputnamen outputele akclassificationheadnamen kerasautomlkerastunerautoeras user asked yesterday
442"problem when getting started on supabase's flutter google auth, google pages redirects back to login_page i have been trying to get this done for a long time now. it's not the common 'appauthredirectscheme': 'com.googleusercontent.apps.account_id' problem. i have followed this tutorial (a couple of times):... google-oauthsupabase-flutter ramonesp 11 asked sep 17, 2023 at 23:37","['google-oauth', 'supabase-flutter']",en,problem getting started supabases clutter google auth google pages redirects back loginpage trying get done long time common appauthredirectscheme comgoogleusercontentappsaccountid problem followed tutorial couple times googleoauthsupabaseclutter ramonesp asked sep
443"i need to make a custom aggregation in power query, by choosing maximum but based on condition i don't seem to understand how to create custom aggregation, please assist. that's the question i asked before, quite similar https://stackoverflow.com/questions/77444245/i-need-to-make-an-aggregation-... powerqueryaggregation ninella23 25 asked nov 19, 2023 at 22:32","['powerquery', 'aggregation']",en,need make custom aggregation power query choosing maximum based condition seem understand create custom aggregation please assist question asked quite similar powerqueryaggregation novella asked nov
444"in angular 6 how make case insensitive url pattern? in my case i want to support same url in case insensitive manner. example: it should support all url localhost:1029/documentation localhost:1029/documentation localhost:1029/documentation localhost:... angularangular5angular6 jitendra 253 asked aug 23, 2018 at 12:36","['angular', 'angular5', 'angular6']",en,angular make case insensitive url pattern case want support url case insensitive manner example support url localhostdocumentation localhostdocumentation localhostdocumentation localhost angularangularangular jitendra asked aug
445"json data to be set as per row in google sheet - getdataasstring i have the code below in apps script and i wanted to set it in my google sheet to be like per row. var jsonfile = datafiles.next(); var json = jsonfile.getblob().getdataasstring(); sheet.getrange('a1'... google-apps-scriptgoogle-sheets newmanguy 3 asked aug 17, 2023 at 17:45","['google-apps-script', 'google-sheets']",en,son data set per row google sheet getdataasstring code apps script wanted set google sheet like per row var jsonfile datafilesnext var son jsonfilegetblobgetdataasstring sheetstrangea googleappsscriptgooglesheets newmanguy asked aug
446"convert prompt-sync require into import method i use prompt-sync module in my node project. const prompt = require('prompt-sync')(); const result = prompt(message); but to keep my typescript code consistent i need to use import instead of ... javascriptnode.jstypescriptinputprompt артур гудиев 1,144 asked jan 22, 2021 at 20:15","['javascript', 'node.js', 'typescript', 'input', 'prompt']",en,convert promptsync require import method use promptsync module node project const prompt requirepromptsync const result promptmessage keep typescript code consistent need use import instead javascriptnodejstypescriptinputprompt artur gudiev asked jan
447"how to get the value of column with corresponding max value of another column i have a table with columns a,b,c.for for each value of colc i want to chose the colb value with the max value of cola i cant use a group by as it leads out col b i have: i want: this has probably ... sql k.dkhk 530 asked aug 21, 2024 at 13:04",['sql'],en,get value column corresponding max value another column table columns abcfor value col want chose col value max value cola cannot use group leads col b want probably sql kdesk asked aug
448"reading and writing sections of a custom binary file format in python i have not worked with an entirely custom file format yet, but the project i am working on requires an entirely new, custom binary file format. i don't know all the best practices for the same (like ... pythonfileserialization libkush 205 asked sep 10, 2023 at 13:16","['python', 'file', 'serialization']",en,reading writing sections custom binary file format python worked entirely custom file format yet project working requires entirely new custom binary file format know best practices like pythonfileserialization libkush asked sep
449"trouble getting an rmarkdown file to render from an r script using the taskscheduler package i am trying to schedule a task using the taskscheduler package that uses an r script to render an r markdown html file. i keep getting an error message saying error: pandoc version 1.12.3 or higher is ... rr-markdownpandocr-taskscheduler z_11122 337 asked nov 9, 2023 at 17:42","['r', 'r-markdown', 'pandoc', 'r-taskscheduler']",en,trouble getting smackdown file render r script using taskscheduler package trying schedule task using taskscheduler package uses r script render r smackdown html file keep getting error message saying error random version higher rrmarkdownpandocrtaskscheduler z asked nov
450"can i get or insert (not upsert) a new document into a collection using one operation? in mongodb, i can do it by two operations(findone+insertone). note that upsert is not acceptable because i don’t want to modify the existing item. this is a critical and frequent operation that i wish ... mongodb long quanzheng 2,421 asked aug 14, 2024 at 17:28",['mongodb'],en,get insert upset new document collection using one operation mongodb two operationsfindinginserting note upset acceptable want modify existing item critical frequent operation wish mongodb long quanzheng asked aug
451"how to properly add a library to a c project in visual studio 2022? i'm trying to compile a program that includes libraries of 2 different sdks. i've added a bit of processing to a pre-compiled c example (asychronousgrab) of the vimbac sdk (an sdk to control and ... cvisual-studiolinkerlibraries atslooking4things 145 asked jan 11, 2024 at 11:06","['c', 'visual-studio', 'linker', 'libraries']",en,properly add library c project visual studio trying compile program includes libraries different sdk added bit processing precompiled c example asychronousgrab simbad sdk sdk control visualstudiolinkerlibraries atslookingthings asked jan
452"can i amend a commit made with vscode to github repo? i learn git and using vscode and just learn the commit ""amend"" command and now trying it on origin (github). i can't find any way to do this. do i need some external tool to do that i don't ... gitgithubvisual-studio-codegit-amend kid 2,207 asked sep 14, 2020 at 10:17","['git', 'github', 'visual-studio-code', 'git-amend']",en,amend commit made uscode github repo learn git using uscode learn commit amend command trying origin github cannot find way need external tool gitgithubvisualstudiocodegitamend kid asked sep
453"delete old logs not working with log4j2 xml configuration i have log4j2 xml configuration. issue is that- log older than 1 day is not getting deleted. log files are in same application root folder. can anyone please help what is the issue <configuration&... log4j2 sachin 29 asked jun 19, 2024 at 16:57",['log4j2'],en,delete old logs working logj xml configuration logj xml configuration issue log older day getting deleted log files application root folder anyone please help issue configuration logj machine asked jun
454"mantine notification text color i am helping my friends develop the frontend of an application, developed in typescript, react and mantine. we have the following notification code and image: code: notifications.show({ id:... cssreactjstypescriptfrontendmantine yağız can aslan 168 asked jun 4, 2023 at 15:35","['css', 'reactjs', 'typescript', 'frontend', 'mantine']",en,machine notification text color helping friends develop frontend application developed typescript react machine following notification code image code notificationsshow id cssreactjstypescriptfrontendmantine yagiz asian asked jun
455"unable to see maui templates in vs 2022 version 17.7 i have vs 2022 17.7, which is the latest version, however in this installation i am unable to see or use maui project templates to start using maui project templates, yesterday (12-aug-2023) i had ... mauivisual-studio-2022 vasanthkani 21 asked aug 13, 2023 at 18:29","['maui', 'visual-studio-2022']",en,unable see mai templates vs version vs latest version however installation unable see use mai project templates start using mai project templates yesterday aug mauivisualstudio vasanthkani asked aug
456"how to run nanohttp daemon as os service on macos? i have a custom application made with nanohttp daemon to control a local printer using a rest api. i could make its os service installer for windows using apache commons daemon, but i'm stuck while ... macosservicenanohttpd tobia 9,577 asked mar 17, 2024 at 13:59","['macos', 'service', 'nanohttpd']",en,run nanohttp demon os service marcos custom application made nanohttp demon control local printer using rest api could make os service installer windows using apache commons demon stuck macosservicenanohttpd tibia asked mar
457"typeerror: received message 257:none is not bytes in azure-servicebus python sdk after consuming some messages from azure servicebus queue, python sdk for azure-servicebus is failing with below error socket.send() raised exception. unexpected error occurred (typeerror('received ... azureservicebusazure-servicebus-queuesazure-python-sdk ramachandraiah putta 162 asked oct 18, 2023 at 6:26","['azureservicebus', 'azure-servicebus-queues', 'azure-python-sdk']",en,typeerror received message none bytes azureservices python sdk consuming messages azure services queue python sdk azureservices failing error socketsend raised exception unexpected error occurred typeerrorreceived azureservicebusazureservicesqueuesazurepythonsdk ramachandraiah putt asked oct
458"how to fix discovery of module-under-test in test code with unittest? i've been struggling with this error and i have no idea of why it happens. modulenotfounderror: no module named 'lambdafunction' this is the folder structure. and for some reason when i try to run ... pythonpython-importpython-unittest diego duarte 139 asked jan 10, 2021 at 2:18","['python', 'python-import', 'python-unittest']",en,fix discovery moduleundertest test code unites struggling error idea happens modulenotfounderror module named lambdafunction folder structure reason try run pythonpythonimportpythonunites diego date asked jan
459"do i need to revoke permissions when a table is dropped as part of a migration i create a table and grant permissions to a user. do i need to revoke the permissions on my downgrade migration which already drops the table? --- up.sql create table if not ... postgresqldatabase-migration ipinak 6,059 asked jul 20, 2023 at 9:45","['postgresql', 'database-migration']",en,need revoke permissions table dropped part migration create table grant permissions user need revoke permissions downgraded migration already drops table upsql create table postgresqldatabasemigration pink asked jul
460"why can't set method in seaborn's displot rotate tick labels, while set_xticklabels works? i'm working with seaborn's displot for creating histograms and facing an issue with rotating x-tick labels. while i can successfully rotate the labels using g.set_xticklabels(rotation=45), i encounter ... pythonseaborn jiani song 1 asked jan 8, 2024 at 12:13","['python', 'seaborn']",en,cannot set method seasons display rotate tick labels setxticklabels works working seasons display creating histograms facing issue rotating xtick labels successfully rotate labels using gsetxticklabelsrotation encounter pythonseaborn piano song asked jan
461"wescan camera auto focus or select camera swift i have made an ingredient scanning app in swift using the wescan git repo as i only want to scan one image at a time and found issues trying to use native libraries. https://github.com/wetransfer/... iosswiftcameraocrautofocus adam first 445 asked dec 17, 2023 at 10:47","['ios', 'swift', 'camera', 'ocr', 'autofocus']",en,scan camera auto focus select camera swift made ingredient scanning app swift using scan git repo want scan one image time found issues trying use native libraries iosswiftcameraocrautofocus adam first asked dec
462"node-canvas issue with loading custom fonts using registerfont() note: i have tried multiple fonts so problem is not in font files... keep getting this error below and output in fallback font... (process:22832): pango-warning **: 12:52:05.268: couldn't load font &... node.jsexpresscanvas mirko cosic 13 asked may 15, 2023 at 11:13","['node.js', 'express', 'canvas']",en,nodecanvas issue loading custom fonts using registerfont note tried multiple fonts problem font files keep getting error output fullback font process tangowarning could load font nodejsexpresscanvas mark comic asked may
463"how to get the epoch time in eastern time? [duplicate] how do i get the time in seconds since epoch of a python datetime in eastern time? import pytz from datetime import datetime, timedelta et_tz = pytz.timezone('america/new_york') initial_start_dt = ... pythontimeepoch bar 17.3k asked aug 25, 2024 at 0:34","['python', 'time', 'epoch']",en,get epoch time eastern time duplicate get time seconds since epoch python daytime eastern time import put daytime import daytime timedelta ettz puttimezoneamericanewyork initialstartdt pythontimeepoch bar k asked aug
464"how to detect which app a user selects from flutter's native share dialog? i'm building a flutter application where users can share content via a share button. when they tap this button, i'm using the share_plus package to show the native share dialog with options like ... androidiosflutterdartshare nandan magdum 11 asked apr 21 at 11:17","['android', 'ios', 'flutter', 'dart', 'share']",en,detect app user selects clutters native share dialog building clutter application users share content via share button tap button using shareplus package show native share dialog options like androidiosflutterdartshare vandal magnum asked apr
465"how to highlight only a certain part of text content in any element tag using js? <p>non-highlighted part. only this part must be highlighted. non-highlighted part.</p> how do i highlight only ""only this part must be highlighted."" part out of the complete ... javascript ashish soni 13 asked jan 24, 2024 at 7:21",['javascript'],en,highlight certain part text content element tag using js nonhighlighted part part must highlighted nonhighlighted part highlight part must highlighted part complete javascript assist song asked jan
466"how to fix the warning ""the number of slides is not enough for loop mode""? swiper loop warning: the number of slides is not enough for loop mode, it will be disabled and not function properly. you need to add more slides (or make duplicates) or lower the values of ... swiper.js ravi padaliya 1 asked yesterday",['swiper.js'],en,fix warning number slides enough loop mode sniper loop warning number slides enough loop mode disabled function properly need add slides make duplicates lower values sniperjs ravi padaliya asked yesterday
467"disable trace an options in nginx-ingress with snippets a security probe recently recommended disabling the trace and options methods for my k8s nginx-ingress. i've been googling for a few days but not gotten anywhere, the searches are a bit vague. i ... nginxnginx-ingressnginx-config robert 57 asked oct 11, 2023 at 14:28","['nginx', 'nginx-ingress', 'nginx-config']",en,disable trace options enginecongress snippets security probe recently recommended disabling trace options methods ks enginecongress googling days gotten anywhere searches bit vague nginxnginxingressnginxconfig robert asked oct
468"how to get git diff similar to that immediately after manual resolve conflict? i have been using git for a long time, sometimes it is necessary to resolve conflicts manually. when the merge is stopped because of a merge failure, i resolve the conflict manually. at this moment i ... gitmergediff nnseva 2,206 asked dec 13, 2023 at 9:48","['git', 'merge', 'diff']",en,get git different similar immediately manual resolve conflict using git long time sometimes necessary resolve conflicts manually merge stopped merge failure resolve conflict manually moment gitmergediff nueva asked dec
469"propagating access token between microservices i am working on microservices application where the client application sends the access token to orders microservice with the post call. when saving the order, the inventory micro-service should be ... spring-securityoauth-2.0microservicesspring-security-oauth2 zilcuanu 3,735 asked oct 19, 2021 at 16:06","['spring-security', 'oauth-2.0', 'microservices', 'spring-security-oauth2']",en,propagating access token microservices working microservices application client application sends access token orders microservice post call saving order inventory microservice springsecurityoauthmicroservicesspringsecurityoath zilcuanu asked oct
470"bytearray to iformfile i am developing some rest api with c# and net core i have a function in my repository which accepts a parameter of type iformfile. public async task<bool> uploadfile(iformfile file) { // ... c#asp.net-corefile-upload skysurfer 883 asked oct 14, 2019 at 14:05","['c#', 'asp.net-core', 'file-upload']",en,bytearray iformfile developing rest api c net core function repository accepts parameter type iformfile public sync task uploadfileiformfile file caspnetprefileupload skysurfer asked oct
471"firefox: cors missing allow header my firefox is issuing an options preflight request to my private backend to make a subsequent get request with credentials. the preflight request includes the headers origin http://localhost:9670 ... httpcors ulrich 1,623 asked oct 7, 2021 at 9:38","['http', 'cors']",en,firefox cars missing allow header firefox issuing options preflight request private backend make subsequent get request credentials preflight request includes headers origin httplocalhost httpcors rich asked oct
472"how to execute .sql files in postgres database i am using postgres database with postgis and pgadmin. i have many .sql files with different sizes like 300mb, 280mb etc to be inserted into database. what is the best way to do it i.e through java ... postgresqlpsql sasikala 539 asked nov 26, 2015 at 17:07","['postgresql', 'psql']",en,execute sql files posters database using posters database posts admin many sql files different sizes like mb mb etc inserted database best way ie java postgresqlpsql sasikala asked nov
473"how to include tss.cpp in another visual studio project i want to include tss.cpp in my visual studio solution, which has 2 projects (call them 'controller', in cpp, and 'driver', in c). i want to use tss.cpp to access tpm functions in both projects (but i'... c++includeimporterrortpm mmorg 21 asked jan 23, 2024 at 12:34","['c++', 'include', 'importerror', 'tpm']",en,include tsscpp another visual studio project want include tsscpp visual studio solution projects call controller cpp driver c want use tsscpp access pm functions projects cincludeimporterrortpm asked jan
474"class org.apache.spark.sql.catalyst.util.genericarraydata cannot be cast to class org.apache.spark.unsafe.types.utf8string 23/09/25 12:49:33 error executor: exception in task 0.0 in stage 11.0 (tid 11) java.lang.classcastexception: class org.apache.spark.sql.catalyst.util.genericarraydata cannot be cast to class org.... apache-spark shaheer shah 35 asked sep 25, 2023 at 7:57",['apache-spark'],en,class orgapachesparksqlcatalystuntilgenericarraydata cannot cast class orgapachesparkunsafetypesutfstring error executor exception task stage tid javalangclasscastexception class orgapachesparksqlcatalystuntilgenericarraydata cannot cast class org apachespark sheer shah asked sep
475"is catching an exception by reference dangerous? please take a look at the following exception throwing and catching: void some_function() { // was std::exception(""message"") in original post, which won't compile throw std::... c++exception somethingsomething 12.3k asked oct 28, 2015 at 9:39","['c++', 'exception']",en,catching exception reference dangerous please take look following exception throwing catching void somefunction stdexceptionmessage original post compile throw std cexception somethingsomething k asked oct
476"what is the difference between async.waterfall and async.series the nodejs async module: https://github.com/caolan/async provides 2 similar methods, async.waterfall and async.series. what is the difference between them? javascriptnode.jsasynchronousnode-async bruce dou 4,771 asked feb 13, 2012 at 10:03","['javascript', 'node.js', 'asynchronous', 'node-async']",en,difference syncwaterfall syncseries nodes sync module provides similar methods syncwaterfall syncseries difference javascriptnodejsasynchronousnodesync bruce dou asked feb
477"how to check for read and write permission in c++ using std::filesystem i have a unix codebase that is using access(path, w_ok) and access(path, r_ok), available in unistd.h, in order to see if the file is writeable/readable. examples at the end of the page here. i have ... c++linuxwindowsunixfilesystems fede2424 77 asked mar 9, 2023 at 12:33","['c++', 'linux', 'windows', 'unix', 'filesystems']",en,check read write permission c using stdfilesystem unix codename using accesspath wok accesspath rok available unith order see file writeablereadable examples end page clinuxwindowsunixfilesystems feed asked mar
478"cannot find serial port support in qt 6.3.2 for some reason i should use qt6 for my project. i need serial port functionality but qt creator cannot find corresponding module. the following error is raised: project error: unknown module(s) in qt:... qtqt-creator roman kazmin 981 asked oct 27, 2022 at 9:57","['qt', 'qt-creator']",en,cannot find serial port support qt reason use qt project need serial port functionality qt creator cannot find corresponding module following error raised project error unknown modules qt qqtcreator roman admin asked oct
479"how to redirect to shopify payment page on choose of any pricing plan in react standlone app i am writing a non-embeeded standlone shopify app in react and node. i am having 3 pricing plans in my app, now i want on select of any plan it should redirect to payment page of shopify i am able to ... reactjsshopify-appshopify-apishopify-api-node shraddha goel 897 asked jun 10, 2023 at 4:27","['reactjs', 'shopify-app', 'shopify-api', 'shopify-api-node']",en,redirect spotify payment page choose pricing plan react standalone app writing nonembedded standalone spotify app react node pricing plans app want select plan redirect payment page spotify able reactjsshopifyappshopifyapishopifyapinode shraddha goal asked jun
480"name error. i keep getting a call back and a name, 'mary' is not defined [closed] name = ""mary"" print(name) mary ======== restart: /users/franklaverde/desktop/variable.py ======= mary traceback (most recent call last): file ""/users/franklaverde/desktop/variable.py&... python-3.x frank laverde 1 asked yesterday",['python-3.x'],en,name error keep getting call back name mary defined closed name mary printname mary restart usersfranklaverdedesktopvariablepy mary traceback recent call last file usersfranklaverdedesktopvariablepy pythonx frank lavender asked yesterday
481"problem: ssh with ngrok tunneling using public key authentification? i want to connect to my home ubuntu server from everywhere without port forwarding, so i decided to use ngrok tunneling. usually i can log in to my server using ssh public key without any problem, but ... sshpublic-keyngrok semih ö. 1 asked aug 16, 2023 at 11:53","['ssh', 'public-key', 'ngrok']",en,problem ssh grow tunneling using public key authentication want connect home ubuntu server everywhere without port forwarding decided use grow tunneling usually log server using ssh public key without problem sshpublickeyngrok semi asked aug
482"linkedin api error: connect etimedout 108.174.10.22:443 or other ip address i am encountering an issue with the linkedin api. when i try to retrieve posts using the following api endpoint: https://api.linkedin.com/rest/posts?author={data}&q=author&count=20 i get the ... linkedin-api shambhu nath 1 asked jul 25, 2024 at 11:24",['linkedin-api'],en,linkedin api error connect timeout ip address encountering issue linkedin api try retrieve posts using following api endpoint get linkedinapi shambhu math asked jul
483"how do i build librevenge static libraries (*.lib) for use in windows? i am unable to find a working solution for building the librevenge static libs for windows. for wider context, i need to build the librevenge static libraries because this is a dependancy for the ... buildstatic-librariescross-compilinggnu-makewindows-subsystem-for-linux shem s 21 asked aug 4, 2023 at 13:45","['build', 'static-libraries', 'cross-compiling', 'gnu-make', 'windows-subsystem-for-linux']",en,build librevenge static libraries lib use windows unable find working solution building librevenge static libs windows wider context need build librevenge static libraries dependency buildstaticlibrariescrosscompilinggnumakewindowssubsystemforlinux asked aug
484"i can't seem to get multiple line inputs into multiple variables in my code i need to be able to input two variables as they pass through two if statements to get specific data from a dataset but i can't seem to get two variable inputs. i've tried using two scanf_s and ... c nathan 11 asked feb 19, 2024 at 15:50",['c'],en,cannot seem get multiple line inputs multiple variables code need able input two variables pass two statements get specific data dataset cannot seem get two variable inputs tried using two scans c nathan asked feb
485"swift : closure declaration as like block declaration we can declare block as below in objective-c. typedef void (^completionblock) (nsstring* completionreason); i'm trying to do this in swift, it give error. func completionfunction(nsstring* ... iosswift mani 17.6k asked jun 10, 2014 at 5:54","['ios', 'swift']",en,swift closure declaration like block declaration declare block objectivec typed void completionblock string completionreason trying swift give error func completionfunctionstring iosswift mani k asked jun
486"why is a dummy nsmenuitem needed to make the next nsmenuitem actually appear? i want to programmatically populate an nsmenutoolbaritem's nsmenu. let toolbaritem = nsmenutoolbaritem(itemidentifier: ...) toolbaritem.image = ... toolbaritem.label = ... toolbaritem.menu.delegate = ... swiftcocoaappkitnsmenunsmenuitem user10711707 205 asked feb 29, 2024 at 11:58","['swift', 'cocoa', 'appkit', 'nsmenu', 'nsmenuitem']",en,dummy menuitem needed make next menuitem actually appear want programmatically populate nsmenutoolbaritems menu let toolbaritem nsmenutoolbaritemitemidentifier toolbaritemimage toolbaritemlabel toolbaritemmenudelegate swiftcocoaappkitnsmenunsmenuitem user asked feb
487"increasing the jvm maximum heap size for memory intensive applications i need to run a java memory intensive application that uses more than 2gb, but i am having problems to increase the heap maximum size. so far, i have tried the following approaches: setting the -xmx ... javajvmjvm-arguments alceu costa 9,909 asked jun 12, 2010 at 22:05","['java', 'jvm', 'jvm-arguments']",en,increasing jv maximum heap size memory intensive applications need run java memory intensive application uses gb problems increase heap maximum size far tried following approaches setting xx javajvmjvmarguments alien costa asked jun
488"icon and text not centered i have the problem that the logout symbol is placed slightly higher than logout. i tried adding margin to make the icon the same height and in the same row as the text, but that doesn't seem to work.
... htmlcss sabrina 65 asked jan 8, 2024 at 6:04","['html', 'css']",en,icon text centered problem logo symbol placed slightly higher logo tried adding margin make icon height row text seem work htmlcss marina asked jan
489grid struct with dda transversal not working properly in ray tracer [closed] by now i've implemented a small optimization introducing bounding boxes for mesh object (if a ray does not hit the bbox it will not check the triangles inside the bbox). to optimize it further i ... c++renderingbounding-boxraytracingdda niccolò tiezzi 183 asked yesterday,"['c++', 'rendering', 'bounding-box', 'raytracing', 'dda']",en,grid struct dda transverse working properly ray tracer closed implemented small optimization introducing founding boxes mesh object ray hit box check triangles inside box optimize crenderingboundingboxraytracingdda nickelo tiezzi asked yesterday
490"getting nothing from second function so i'm making discord bot and i'm having problems. when i change (add) item in the dictonary in on_message() function, in loop() function it just printing ""current mps: {}"" here part of the ... pythondiscord tvixter 1 asked feb 8, 2024 at 18:28","['python', 'discord']",en,getting nothing second function making discord bot problems change add item dictionary onmessage function loop function printing current mps part pythondiscord twitter asked feb
491"received empty response from zabbix agent at [xx.xxx.xx.xx] i am trying to register zabbix agent to zabbix server but facing this error[received empty response from zabbix agent at [xx.xxx.xx.xx]. assuming that agent dropped connection because of access ... amazon-web-servicesamazon-ec2amazon-elbzabbixzabbix-api shubham jain 199 asked mar 25, 2021 at 13:51","['amazon-web-services', 'amazon-ec2', 'amazon-elb', 'zabbix', 'zabbix-api']",en,received empty response rabbi agent xxxxxxxxx trying register rabbi agent rabbi server facing errorreceived empty response rabbi agent xxxxxxxxx assuming agent dropped connection access amazonwebservicesamazonecamazonelbzabbixzabbixapi shubham jain asked mar
492"gpu runs out of memory on azureml studio when uing yolov8 i am using notebooks on azure ai machine learning studio to train a classification model using yolov8 (pip install ultralytics). on training, i get an error that suggests my compute is out of memory: ... azure-machine-learning-serviceyolov8 alex p 12.5k asked nov 18, 2023 at 15:19","['azure-machine-learning-service', 'yolov8']",en,gpu runs memory azure studio using color using notebooks azure ai machine learning studio train classification model using color pip install ultralytics training get error suggests compute memory azuremachinelearningserviceyolov alex p k asked nov
493"how can i open a new tab which is not active with html or javascript? [duplicate] i want to open a url with new tab, but it should be not active. <a href=""example.com"" target='_blank' rel=""noopener noreferrer"">example</a> i tried above code, but it ... javascript boketeボケて 41 asked oct 4, 2023 at 12:31",['javascript'],en,open new tab active html javascript duplicate want open url new tab active example tried code javascript boketebokete asked oct
494"how to disable page-break before a long iframe while printing? there is a page-break before a long iframe while printing the webpage however the iframe itself has the possibility of breaking into different pages. i want to avoid page-break and blank space before ... htmlcssiframeprintingpage-break ali sheikhpour 11.2k asked mar 26, 2024 at 7:59","['html', 'css', 'iframe', 'printing', 'page-break']",en,disable pagebreak long iframe printing pagebreak long iframe printing webpage however iframe possibility breaking different pages want avoid pagebreak blank space htmlcssiframeprintingpagebreak ali sheikhpour k asked mar
495"how to handle template related compilation errors recently i met a c2908 error: explicit specialization xxx has already been instantiated the reason is that, for our myclient class, we have the operator less specifically defined as to compare ... c++templatescompilation athos 6,457 asked mar 6, 2024 at 11:54","['c++', 'templates', 'compilation']",en,handle template related compilation errors recently met c error explicit specialization xxx already instantiated reason client class operator less specifically defined compare ctemplatescompilation ethos asked mar
496"my svg chess images are not changing their color [closed] i am building a chess game in my js/css part of code when i try to change my svg images they're not working idk why, i used fill in my css on that very element which is a child, but nothing is wrong ... javascript abdo jama 21 asked jan 22, 2024 at 15:49",['javascript'],en,svg chess images changing color closed building chess game jscss part code try change svg images working id used fill css element child nothing wrong javascript ado jama asked jan
497"get the string within brackets in python i have a sample string <alpha.customer[cus_y4o9qmezaugtnw] active_card=<alpha.alphaobject[card] ...>, created=1324336085, description='customer for my test app', livemode=false> i only ... pythonregexbrackets user993563 19.5k asked dec 20, 2011 at 0:00","['python', 'regex', 'brackets']",en,get string within brackets python sample string created descriptioncustomer test app livemodefalse pythonregexbrackets user k asked dec
498"how does the linux kernel know what to put in platform_data? i'm analyzing the device driver for e.g. ti tca6408 device, the driver is gpio-pca953x. in the ->probe() function there is a part when the platform data is retrieved from the device: static int ... linux-kernellinux-device-driverdevice-tree bielu000 2,241 asked mar 20, 2024 at 11:19","['linux-kernel', 'linux-device-driver', 'device-tree']",en,linux kernel know put platformdata analyzing device driver eg ti tca device driver piopcax probe function part platform data retrieved device static int linuxkernellinuxdevicedriverdevicetree field asked mar
499"aggregation of user defined types in postgresql with postgresql client under node.js i would be grateful for your advice. i use postgres 16 and postgresql client under node.js there is a table with a user defined type: create type my_type as enum ('value1', 'value2'); create table ... node.jspostgresql alexander paschenko 751 asked feb 2, 2024 at 8:22","['node.js', 'postgresql']",en,aggregation user defined types postgresql postgresql client nodejs would grateful advice use posters postgresql client nodejs table user defined type create type mytype num value value create table nodejspostgresql alexander paschenko asked feb
500"npm warn: [email protected] requires a peer of popper.js i have follow dependency part in package.json: ""dependencies"": { ""bootstrap"": ""*"", ""bootstrap-datepicker"": ""^1.7.1"", ""bower"": ""^1.8.2"", ""chosen-js"": ""^1.8.2"", ""datatables.net-dt""... twitter-bootstrapnpmbootstrap-4 olga pshenichnikova 1,581 asked mar 13, 2018 at 12:56","['twitter-bootstrap', 'npm', 'bootstrap-4']",en,num warn email protected requires peer copperjs follow dependency part packageson dependencies bootstrap bootstrapdatepicker power chosenjs datatablesnetdt twitterbootstrapnpmbootstrap olga pshenichnikova asked mar
501"how to call grandparent's `__str__` from child class in python? suppose we have 3 classes grandparent,parent and child where parent inherits from grandparent and child inherits from parent. i want to call the __str__ of grandparent in class child. how can i do it? ... pythoninheritance mohsen_fatemi 3,401 asked sep 8, 2023 at 18:06","['python', 'inheritance']",en,call grandparents str child class python suppose classes grandparentparent child parent inherits grandparent child inherits parent want call str grandparent class child pythoninheritance chosenfate asked sep
502"execute independent python file that continues running even after parent file terminates on windows i have been scouring the internet for a solutions and while there have been similar threads to this, they appear to be a little dated or for *nix systems. here is my situation: i have a python 3.9 ... pythonpython-3.xwindowssubprocess luke m 3 asked apr 26, 2024 at 21:50","['python', 'python-3.x', 'windows', 'subprocess']",en,execute independent python file continues running even parent file terminates windows scoring internet solutions similar threads appear little dated nix systems situation python pythonpythonxwindowssubprocess luke asked apr
503"tableau wdc error access to xmlhttprequest at ""https://apex/api"" from origin ""http://xyz.8888"" has been blocked by cors policy i am getting this error in browser console when running my javascript and jquery code. does anyone have this error in past? any help will be appreciated. error: condition: without any datatype ... javascriptjquerycorstableau-api user19354065 11 asked aug 8, 2024 at 23:26","['javascript', 'jquery', 'cors', 'tableau-api']",en,tableau wdc error access xmlhttprequest origin httpxyz blocked cars policy getting error browser console running javascript query code anyone error past help appreciated error condition without datatype javascriptjquerycorstableauapi user asked aug
504"valueerror: `run` not supported when there is not exactly one input key, got ['question', 'documents'] getting the error while trying to run a langchain code. valueerror: `run` not supported when there is not exactly one input key, got ['question', 'documents']. traceback: file ""c:\users\aviparna.... pythonlangchain daremitsu 643 asked may 8, 2023 at 10:24","['python', 'langchain']",en,valueerror run supported exactly one input key got question documents getting error trying run langchain code valueerror run supported exactly one input key got question documents traceback file cusersaviparna pythonlangchain daremitsu asked may
505"postgresql data not showing in docker container i need some help, i'm stuck in docker and can't find it out. i'm using windows for a django app and docker i'm using pgadmin4 with postgresql 16 and created a new server for docker the log for the ... pythondjangopostgresqldockerdocker-compose sandorka 1 asked nov 23, 2023 at 20:47","['python', 'django', 'postgresql', 'docker', 'docker-compose']",en,postgresql data showing decker container need help stuck decker cannot find using windows tango app decker using admin postgresql created new server decker log pythondjangopostgresqldockerdockercompose pandora asked nov
506"generate a random number with given bit size in rust i am trying to generate a random number with aribitorary bit size in rust using rug. i create a function like this: fn bit_str(bitlen: usize) -> string { let vs = vec!['0','1']; let mut ... rust jihyun 1,125 asked jun 11, 2023 at 13:33",['rust'],en,generate random number given bit size rust trying generate random number arbitrary bit size rust using rug create function like fn bitstrbitten size string let vs vec let rust hyun asked jun
507"complex java 17 regex with multiple token types and segments i am trying to build a complex java 17 regex and am failing somewhere. the regex/substring i am looking to match is called a ""metric set"". a metric set consists of 6 segments, and each of ... javaregex hotmeatballsoup 675 asked feb 26, 2024 at 15:23","['java', 'regex']",en,complex java regex multiple token types segments trying build complex java regex failing somewhere regexsubstring looking match called metric set metric set consists segments javaregex hotmeatballsoup asked feb
508"polars: how to prevent: polars.exceptions.invalidoperationerror: `min` operation not supported for dtype `null` hi i have the following data frame with only one row, that can contain an empty list (with only one value null). when i try to get the min over the list, and the one row dataframe does contain only an ... pythonpython-polarsdata-wranglingdtype björn 1,842 asked apr 5, 2024 at 23:54","['python', 'python-polars', 'data-wrangling', 'dtype']",en,polar prevent polarexceptionsinvalidoperationerror min operation supported type null hi following data frame one row contain empty list one value null try get min list one row dataframe contain pythonpythonpolarsdatawranglingdtype bjoright asked apr
509"lookup table in r by matching ranges i have a table: chr pos 10 4342 20 100 22 5422 i have another lookup: chr start end gene 10 4000 5999 abc1 20 50 200 jht 22 5000 6000 klo desired output: chr pos 10 4342 abc1 20 ... rlookup tacrolimus 532 asked mar 3, 2023 at 17:07","['r', 'lookup']",en,lookup table r matching ranges table chr pos another lookup chr start end gene abc jet ko desired output chr pos abc lookup tacrolimus asked mar
510"facebook messenger and whatsapp opengraph not showing image i am using nuxt 3 ssr with useseometa for pages/posts/[id].vue like this useseometa({ title: () => post.value?.title, description: () => post.value?.subtitle, keywords: () => ... server-side-renderingfacebook-opengraphwhatsappnuxt3.jsfacebook-messenger sovai 144 asked jul 30, 2024 at 9:49","['server-side-rendering', 'facebook-opengraph', 'whatsapp', 'nuxt3.js', 'facebook-messenger']",en,facebook messenger whatsapp opengraph showing image using next ssr useseometa pagespostsidvue like useseometa title postvaluetitle description postvaluesubtitle keywords serversiderenderingfacebookopengraphwhatsappnuxtfacebookmessenger solar asked jul
511"flutter update single data records in futurebuilder situation: i am using flutter web only (requirement). i have some kind of a datatable (wrapped for style issues)in a statefulwidget, which shows the customer data fetched from the backend. the ... flutternotificationsfuture nico r. 86 asked aug 30, 2024 at 6:14","['flutter', 'notifications', 'future']",en,clutter update single data records futurebuilder situation using clutter web requirement kind debatable wrapped style issuesin statefulwidget shows customer data fetched backend flutternotificationsfuture nico r asked aug
512"is there a way to append the time stamp of each command that runs as part of cmake? i am trying to debug some issue where i suspect that build dependencies are not set properly causes issues. i want to confirm the same. for that i want to log the time with seconds of each command ... cmakeninja vam 63 asked jul 31, 2023 at 13:39","['cmake', 'ninja']",en,way append time stamp command runs part make trying debug issue suspect build dependencies set properly causes issues want confirm want log time seconds command cmakeninja vam asked jul
513"search with typeorm works partially but doesn't return all relations i have my entities like this: @entity('user') export class user { @primarygeneratedcolumn('uuid') id: string; @manytomany(() => product, { ondelete: 'no action', onupdate: 'cascade' }) @... postgresqlsearchfiltertypeorm mehayoo 19 asked aug 22, 2023 at 10:59","['postgresql', 'search', 'filter', 'typeorm']",en,search typeorm works partially return relations entities like entityuser export class user primarygeneratedcolumnuuid id string manytomany product undelete action update cascade postgresqlsearchfiltertypeorm mehayoo asked aug
514"systemd target with services, services ignoring environmentfile directive [closed] i have the following systemd .target: [unit] description=my target after=network-online.target wants=one-service@%i.service wants=two-service@%i.service bindsto=one-service@%i.service bindsto=two-... linuxredhatsystemd kevin huntly 1 asked 2 days ago","['linux', 'redhat', 'systemd']",en,system target services services ignoring environmentfile directive closed following system target unit descriptionmy target afternetworkonlinetarget wantsoneserviceiservice wantstwoserviceiservice bindsoneserviceiservice bindstwo linuxredhatsystemd kevin hunt asked days ago
515how to save cell output for a dataframe i have the problem that the output for isin_dataframes is somehow not stored correctly if i want to use it in another cell. so instead of the whole dataframe i only get one row back. please apologize ... pythonpandasdataframedictionary alex 1 asked apr 20 at 10:24,"['python', 'pandas', 'dataframe', 'dictionary']",en,save cell output dataframe problem output isbndataframes somehow stored correctly want use another cell instead whole dataframe get one row back please apologize pythonpandasdataframedictionary alex asked apr
516"concurrent threads adding to arraylist at same time - what happens? we have multiple threads calling add(obj) on an arraylist. my theory is that when add is called concurrently by two threads, that only one of the two objects being added is really added to the ... javaconcurrencysynchronizationarraylist marcus leon 56.8k asked apr 26, 2010 at 18:46","['java', 'concurrency', 'synchronization', 'arraylist']",en,concurrent threads adding arraylist time happens multiple threads calling addobj arraylist theory add called concurrently two threads one two objects added really added javaconcurrencysynchronizationarraylist marcus leon k asked apr
517"react build config image path css my config works with ""react-scripts"": ""3.4.3"" and refuses to work with ""react-scripts"": ""5.0.1"". when building it gives the following error module.rules[2].... reactjswebpackbuild den harris 1 asked jul 8, 2024 at 16:02","['reactjs', 'webpack', 'build']",en,react build config image path css config works reactscripts refuses work reactscripts building gives following error modulerules reactjswebpackbuild den harris asked jul
518"having problem getting a formhandler to work i always get a fatal error from my $stmt->bind_param or $stmt->execute, i think it should be that the connection to my database failed, yet i cant seem to find the problem. formhandler.php: <?... phpmysqliadodb-php yoshi 3 asked feb 5, 2024 at 10:23","['php', 'mysqli', 'adodb-php']",en,problem getting formhandler work always get fatal error statbindparam statexecute think connection database failed yet cannot seem find problem formhandlerphp phpmysqliadodbphp joshi asked feb
519"how to call std::for_each on a vector of std::function without lambda? i want to callback functions, that are stored in a vector, e.g., std::vector<std::function<void()> xs{}; std::for_each(xs.begin(), xs.end(), [](auto& func) { func(); }); but how do i ... c++stl sheldon 407 asked oct 28, 2023 at 14:12","['c++', 'stl']",en,call stdforeach vector stdfunction without lambda want rollback functions stored vector eg stdvector xs stdforeachxsbegin xsend auto func func cstl seldom asked oct
520"name expected issue - convert json to class i am trying to convert json string into instance of a class. there is 'name expected' error as below image. i could not find any solution from googling. i added below dependency into build.gradle(app)... androidgson denis jung 175 asked may 31, 2024 at 12:34","['android', 'gson']",en,name expected issue convert son class trying convert son string instance class name expected error image could find solution googling added dependency buildgradeapp androidgson denis jung asked may
521"driver.find_element can't find an element by ""class_name"" i tried to use driver.find_element, by ""class_name"" to find button and click on it for expanding rooms on - https://www.qantas.com/hotels/properties/18482?adults=2&checkin=2024-04-16&... pythonhtmlselenium-webdriverweb-scraping alexia 23 asked apr 6, 2024 at 13:54","['python', 'html', 'selenium-webdriver', 'web-scraping']",en,driverfindelement cannot find element classname tried use driverfindelement classname find button click expanding rooms pythonhtmlseleniumwebdriverwebscraping alexa asked apr
522"is it possible to have multiple default mysql servers in phpmyadmin using docker i'm trying to build enviroment using docker with two mysql servers, and one phpmyadmin server to easily analyze data during development. my docker-compose.yml looks like this. version: ""3.9"" ... mysqldockerdocker-composephpmyadmin ventan 55 asked feb 22, 2022 at 11:40","['mysql', 'docker', 'docker-compose', 'phpmyadmin']",en,possible multiple default servers phpmyadmin using decker trying build environment using decker two servers one phpmyadmin server easily analyze data development deckercomposeml looks like version mysqldockerdockercomposephpmyadmin mental asked feb
523"how to sum values across dicts? i'm using python 3.7. i have a list of dicts that and i want to create a concatenated dict where that concatenated dicts sums over values (grouped by keys) per key in the initial list of dicts. so e.g.... pythondictionarypython-3.7 24n8 2,248 asked apr 18 at 15:20","['python', 'dictionary', 'python-3.7']",en,sum values across dict using python list dict want create concatenated dict concatenated dict sums values grouped keys per key initial list dict eg pythondictionarypython n asked apr
524"visual studio 22 asp.net web forms: prevent designer from automatically opening the current page when debugging when i run my web forms application in vs 2022, the designer automatically opens every page i navigate to. so at startup, site.master and login.aspx are automatically opened (the designer displays ... webformsvisual-studio-2022designer cleo 1,201 asked jan 16, 2023 at 10:15","['webforms', 'visual-studio-2022', 'designer']",en,visual studio aspnet web forms prevent designer automatically opening current page debugging run web forms application vs designer automatically opens every page navigate startup sitemaster loginaspx automatically opened designer displays webformsvisualstudiodesigner ceo asked jan
525"trying to make code changes to dockhub image uploaded to azure functions i have a docker image as a private repo in dockhub which is in turn hosted in an azure function. everything works well but we have a need to make minor refactors to the the code within. how can i push/... docker t0wt13m5 21 asked mar 20, 2024 at 16:49",['docker'],en,trying make code changes dockhub image uploaded azure functions decker image private repo dockhub turn hosted azure function everything works well need make minor reactors code within push decker twtm asked mar
526"how to make a responsive menubar component of primeng with grid system? i am making a responsive web. i have problems with the menubar component of primeng. i want to have the hamburger mode when i shrink the window: the problem is using grid system of primeflex and ... gridresponsiveprimengmenubarprimeflex pevi 55 asked sep 26, 2023 at 10:18","['grid', 'responsive', 'primeng', 'menubar', 'primeflex']",en,make responsive menubar component priming grid system making responsive web problems menubar component priming want hamburger mode shrink window problem using grid system primeflex gridresponsiveprimengmenubarprimeflex evi asked sep
527"issue using express-handlebars in node.js – ""shop.hbs"" not found even though it's in views folder i'm trying to use express-handlebars with node.js, but i keep getting an error that says the view file can't be found. the error specifically mentions that it can't locate shop.hbs, even though the ... node.jshandlebars.js emzar chichoevi 1 asked 18 hours ago","['node.js', 'handlebars.js']",en,issue using expresshandlers nodejs shophbs found even though views folder trying use expresshandlers nodejs keep getting error says view file cannot found error specifically mentions cannot locate shophbs even though nodejshandlebarsjs mar chichoevi asked hours ago
528"how to adb pull and auto rename long filenames? i'm trying to backup data from a phone (specifically a samsung note 10+) using adb pull, it is a lot of data (over 200gb), and every time it stops due to some files having long filenames (the 260 ... androidwindowsadbrenamebatch-rename powblock 11 asked aug 14, 2023 at 15:19","['android', 'windows', 'adb', 'rename', 'batch-rename']",en,adb pull auto rename long filename trying backup data phone specifically samsung note using adb pull lot data gb every time stops due files long filename androidwindowsadbrenamebatchrename powblock asked aug
529how to set up external fonts in tcpdf environment php 8.2 laravel 9 docker-compose running on aws cloud with docker platform issue description i'm developing a feature that uses tcpdf (+ fpdi) to write text on an existing pdf template. ... phplaraveldockertcpdf dora-bot 11 asked 2 days ago,"['php', 'laravel', 'docker', 'tcpdf']",en,set external fonts pdf environment php travel deckercompose running aws cloud decker platform issue description developing feature uses pdf di write text existing pdf template phplaraveldockertcpdf dorabot asked days ago
530"multi-select combobox with comma separation between selections - making sure no comma at end i am using the below vba code to put comma separation between combobox (lsthomeroom) multi-selections. however, my code is giving me a comma at the end of the list. how can i amend my code to remove ... excelvbacomboboxmulti-select pauldee 19 asked oct 18, 2023 at 10:18","['excel', 'vba', 'combobox', 'multi-select']",en,multiselect combobox comma separation selections making sure comma end using via code put comma separation combobox lsthomeroom multiselections however code giving comma end list amend code remove excelvbacomboboxmultiselect pauldee asked oct
531"render pdf from jspdf for lwc i’ve built a lightning web component that uses jspdf to assemble a multi-page pdf on the fly. in my generateandpreviewpdf() method, i: load jspdf and custom fonts draw a custom header and body onto ... lwc rushika pawar 1 asked 19 mins ago",['lwc'],en,render pdf pdf loc built lightning web component uses pdf assemble multipage pdf fly generateandpreviewpdf method load pdf custom fonts draw custom header body onto loc russia war asked mins ago
532"scala 3 manifest replacement my task is to print out type information in java-like notation (using <, > for type arguments notation). in scala 2 i have this small method using scala.reflect.manifest as a source for type ... scalascala-macrosscala-3 alex 7,956 asked sep 6, 2021 at 8:56","['scala', 'scala-macros', 'scala-3']",en,scale manifest replacement task print type information javalike notation using type arguments notation scale small method using scalereflectmanifest source type scalascalamacrosscala alex asked sep
533"i cannot import web3 in python in colab.research.google.com i am trying to use web3 library in colab.research.google.com/ using the following code from web3 import web3 after i installed it using the following code !pip install web3 but i am getting the error ... pythonimportweb3py mohamed rahouma 1,236 asked aug 5, 2023 at 16:33","['python', 'import', 'web3py']",en,cannot import web python colaresearchgooglecom trying use web library colaresearchgooglecom using following code web import web installed using following code pip install web getting error pythonimportwebpy mohamed tahoma asked aug
534"how-to log the authentication traffic generated by graphserviceclient? i am using nuget packages microsoft.graph 5.29.0 and azure.identity 1.10.2 in .net framework 4.8. i implemented a delegatinghandler as documented in https://github.com/microsoftgraph/msgraph-sdk-... microsoft-graph-api yvand 83 asked oct 30, 2023 at 13:18",['microsoft-graph-api'],en,howto log authentication traffic generated graphserviceclient using nugget packages microsoftgraph azureidentity net framework implemented delegatinghandler documented microsoftgraphapi yvind asked oct
535"react-data-table-component : pagination : error: hydration failed because the initial ui does not match what was rendered on the server i wanted to create datatables with react-data-table-component, but the pagination keep generating the error: error: hydration failed because the initial ui does not match what was rendered on the ... reactjsnext.jscodesandboxreact-data-table-componenthydration yeln 775 asked jan 10, 2023 at 9:43","['reactjs', 'next.js', 'codesandbox', 'react-data-table-component', 'hydration']",en,reactdatatablecomponent imagination error hydration failed initial ui match rendered server wanted create datatables reactdatatablecomponent imagination keep generating error error hydration failed initial ui match rendered reactjsnextjscodesandboxreactdatatablecomponenthydration yen asked jan
536"how to access shared google drive files through python? i try to access shared google drive files through python. i have created an oauth 2.0 clientid as well as the oauth consent. i have copy-pasted this code: https://github.com/googleworkspace/python-... pythongoogle-drive-apigoogle-drive-shared-driveaws-databricks szabolcs magyar 409 asked may 20, 2021 at 15:49","['python', 'google-drive-api', 'google-drive-shared-drive', 'aws-databricks']",en,access shared google drive files python try access shared google drive files python created oath client well oath consent copypasted code pythongoogledriveapigoogledriveshareddriversdatabricks szabolcs magyar asked may
537"understanding sqs message receive amount i have a queue which is supposed to receive the messages sent by a lambda function. this function is supposed to send each different message once only. however, i saw a scary amount of receive count ... amazon-web-servicesaws-lambdaamazon-sqs memphis meng 1,681 asked aug 11, 2022 at 19:44","['amazon-web-services', 'aws-lambda', 'amazon-sqs']",en,understanding sq message receive amount queue supposed receive messages sent lambda function function supposed send different message however saw scary amount receive count amazonwebservicesawslambdaamazonsq memphis men asked aug
538"api data is being passed but not being rendered i am using nextjs and woocommerce rest api to build a ecommerce site. but i have been facing issues with rendering products/data from woocommerce to nextjs frontend. i have setup the endpoint for ... wordpressnext.jswoocommercewoocommerce-rest-api arimtiaz 1 asked apr 28, 2024 at 15:27","['wordpress', 'next.js', 'woocommerce', 'woocommerce-rest-api']",en,api data passed rendered using next woocommerce rest api build ecommerce site facing issues rendering productsdata woocommerce next frontend setup endpoint wordpressnextjswoocommercewoocommercerestapi arimtiaz asked apr
539"knowing std::once_flag is used without invoking std::call_once (set once_flag after task finishes successfully) edit: this is an xy problem but keep the original title as well. it might help other people having the same xy problem. the goal should be: ""have std::once_flag flipped only after the task is ... c++multithreadingc++11initialization louis go 2,618 asked jul 7, 2023 at 5:16","['c++', 'multithreading', 'c++11', 'initialization']",en,knowing stdonceflag used without invoking stdcallonce set onceflag task finishes successfully edit xy problem keep original title well might help people xy problem goal stdonceflag flipped task cmultithreadingcinitialization louis go asked jul
540"the android app bundle was signed with the wrong key. select the correct key and try again `created a new key (android/app/upload-keystore.jks) and what should i do to change it in google play console? because i lost the new key (accidentally deleted it) there are no copies........ terminal:... androidflutterkotlindartgoogle-play-console даулет жунусов 1 asked dec 18, 2023 at 0:52","['android', 'flutter', 'kotlin', 'dart', 'google-play-console']",en,android app bundle signed wrong key select correct key try created new key androidappuploadkeystonejk change google play console lost new key accidentally deleted copies terminal androidflutterkotlindartgoogleplayconsole daulet zhunusov asked dec
541"angular file upload issue: receiving ""c:\fakepath"" in database angular file upload issue: receiving ""c:\fakepath"" in database i'm working on an angular application where i've implemented a feature to allow users to upload image files. my goal is to send ... angular k s 1 asked sep 1, 2023 at 6:36",['angular'],en,angular file upload issue receiving cfakepath database angular file upload issue receiving cfakepath database working angular application implemented feature allow users upload image files goal send angular k asked sep
542"downloading a file from an api i need to download the file coming from an api call, i've tried pretty anything, the last try was creating a blob with the ""file"" i receive in the api, how can i do it? if(tipo_societa == &... javascriptfiledownload federico pavone 31 asked jul 19, 2023 at 9:37","['javascript', 'file', 'download']",en,downloading file api need download file coming api call tried pretty anything last try creating blob file receive api iftiposociety javascriptfiledownload frederick alone asked jul
543"how to rearrange array in alternating positive and negative number? please help me to write a function to re-arrange positive and negative numbers. i tried below function, it's not working as expected. q)list:1 2 3 -4 -1 4 q)f:{p:count p1:l where (signum l:asc x) &... kdb+ rajasekhar 55 asked dec 22, 2023 at 22:10",['kdb+'],en,rearrange array alternating positive negative number please help write function rearrange positive negative numbers tried function working expected qlist qfpcount pl signup lasc x db rajasekhar asked dec
544"oxford instruments log parser [closed] we have oxford instrument plasma parser, but we don't know how to interpret the data. does anyone know how to parse it to structured dataframe? dummy data: 0000d 046081 log_data_file 1562626800 1039c ... python ties 1 asked 1 hour ago",['python'],en,oxford instruments log parser closed oxford instrument plasma parser know interpret data anyone know parse structured dataframe dummy data logdatafile c python ties asked hour ago
545"""docker: 'compose' is not a docker command"" when running docker compose after installing the latest version of docker desktop on my m1 mac pro, i can't seem to run docker compose despite having all the correct files installed. i've tried running docker-compose and docker ... dockerdocker-compose flik 425 asked nov 13, 2022 at 7:29","['docker', 'docker-compose']",en,decker compose decker command running decker compose installing latest version decker desktop mac pro cannot seem run decker compose despite correct files installed tried running deckercompose decker dockerdockercompose flip asked nov
546"running scully in an angular 15 project? i'm upgrading a angular 12 project to an angular 15 project and attempting to run scully on it again. before this worked fine. ng add @scullyio/init --skip-confirmation --defaults ng build npx scully -... javascriptangulartypescriptscullyangular-scully ole 47.6k asked apr 20, 2023 at 18:24","['javascript', 'angular', 'typescript', 'scully', 'angular-scully']",en,running sculls angular project upgrading angular project angular project attempting run sculls worked fine ng add scullyioinit skipconfirmation defaults ng build px sculls javascriptangulartypescriptscullyangularsculls ole k asked apr
547"unable to checkout working tree warning: clone succeeded, but checkout failed i am trying to clone a private repository facing this error error image cloning into 'c:\users\username\folder\word-add-in'... remote: enumerating objects: 6786, done. remote: counting objects: 100% (... gitgithubgit-clone m јǚйáĩď 25 asked mar 26, 2024 at 4:25","['git', 'github', 'git-clone']",en,unable checkout working tree warning clone succeeded checkout failed trying clone private repository facing error error image cloning cusersusernamefolderwordaddin remote enumeration objects done remote counting objects gitgithubgitclone juiaid asked mar
548"can't build react native app after upgrade i'm getting this error: > configure project :react-native-vision-camera visioncamera: node_modules/ found at: /home/ed/sc/shuttlecontrol-driver/node_modules visioncamera: building with hermes... ... androidreact-native edadma 21 asked jul 6, 2023 at 12:39","['android', 'react-native']",en,cannot build react native app upgrade getting error configure project reactnativevisioncamera visioncamera nodemodules found homeedscshuttlecontroldrivernodemodules visioncamera building heroes androidreactnative edema asked jul
549"how to install conda without anaconda or miniconda installer? i don’t want to use anaconda or miniconda as they install their own version of python. i need just the conda package manager which i can use with my existing version of python in existing virtual env. ... pythonanacondacondaminiconda parag chaudhari 348 asked apr 29, 2021 at 7:02","['python', 'anaconda', 'conda', 'miniconda']",en,install honda without anaconda miniconda installer want use anaconda miniconda install version python need honda package manager use existing version python existing virtual env pythonanacondacondaminiconda para chaudhari asked apr
550"why i am getting error during adding migration? an error occurred while accessing the microsoft.extensions.hosting services. continuing without the application service provider. error: some services are not able to be constructed (error while ... c#asp.net-core.net-core prajwal lama 5 asked sep 3, 2023 at 12:08","['c#', 'asp.net-core', '.net-core']",en,getting error adding migration error occurred accessing microsoftextensionshosting services continuing without application service provider error services able constructed error caspnetcorenetcore prajwal lama asked sep
551"how to sort by fetched properties with distinct jpa specifications i use spring boot 1.5.3.release and for me it's unclear how to sort by properties of nested objects with distinct and specifications because of: caused by: org.postgresql.util.psqlexception: error: ... sortingjpaspring-data-jpadistinctcriteria-api roman danilov 371 asked apr 6, 2021 at 19:58","['sorting', 'jpa', 'spring-data-jpa', 'distinct', 'criteria-api']",en,sort fetched properties distinct ja specifications use spring boot release unclear sort properties nested objects distinct specifications caused orgpostgresqluntilpsqlexception error sortingjpaspringdatajpadistinctcriteriaapi roman danilov asked apr
552"how to dynamically change css filter property in next.js with framer motion const heroimage = () => { let windowheight = window.innerheight; const { scrolly } = usescroll(); const indicator = usetransform( scrolly, [0, windowheight], ['100%','20%'] ) ... next.jsframer-motion migel s. sugiarto 90 asked oct 18, 2023 at 14:24","['next.js', 'framer-motion']",en,dynamically change css filter property nextjs frame motion const heritage let windowheight windowinnerheight const scroll usescroll const indicator usetransform scroll windowheight nextjsframermotion miguel sugiarto asked oct
553"google cloud build failed to create shim task: oci runtime create failed i am experience issue in cloud build. i am trying to deploy test terraform resource in google cloud. below is error snapshot i am facing , below is build steps i am using, substitutions: ... google-cloud-platformterraformdevopsgoogle-cloud-build hardik patel 179 asked nov 23, 2023 at 6:22","['google-cloud-platform', 'terraform', 'devops', 'google-cloud-build']",en,google cloud build failed create task oci runtime create failed experience issue cloud build trying deploy test terraform resource google cloud error snapshot facing build steps using substitutions googlecloudplatformterraformdevopsgooglecloudbuild hard patel asked nov
554"what does argument ""bound"" mean in typing.typevar? so i am trying to learn typing module and i am completely stuck on bound= part. i've read this comprehensive topic a couple a times, but since i am newbie to this i didn't understand much. can you ... pythonpython-typing vlad vlad 180 asked jul 4, 2021 at 12:55","['python', 'python-typing']",en,argument bound mean typingtypevar trying learn typing module completely stuck bound part read comprehensive topic couple times since newbie understand much pythonpythontyping glad glad asked jul
555"sonar stats - line is hit by the unit tests but still displayed as uncovered sonar web frontend shows displays the line as uncovered, while it's hit by at least one unit test (we temporarily put an exception inside the condition and it's thrown, so we know for sure that's it's ... c#sonarqube vladimir_1969_2 111 asked sep 25, 2024 at 10:55","['c#', 'sonarqube']",en,sonar stats line hit unit tests still displayed uncovered sonar web frontend shows displays line uncovered hit least one unit test temporarily put exception inside condition thrown know sure csonarqube vladimir asked sep
556"fluent validation cascademode.stop doesnt work on childrules validator class like below and it is fluentvalidation 9.3.0. i want to return first failure message from this code block but every time it returns all failure messages. i didnt see any example in ... c#fluentvalidation unknown artist 153 asked aug 22, 2023 at 11:10","['c#', 'fluentvalidation']",en,fluent validation cascademodestop work childrules validation class like fluentvalidation want return first failure message code block every time returns failure messages see example cfluentvalidation unknown artist asked aug
557"why python allocate memory to string is different strategy? string type uses unicode representation. unicode string can take up to 4 bytes per character depending on the encoding. i have know python use three kinds of internal representations for unicode ... python-3.xstringlisttuples krupesh patel 3 asked jan 30, 2024 at 19:16","['python-3.x', 'string', 'list', 'tuples']",en,python allocate memory string different strategy string type uses unicode representation unicode string take bytes per character depending encoding know python use three kinds internal representations unicode pythonxstringlisttuples krupesh patel asked jan
558"the 'await' operator can only be used within an async lambda expression i've got a c# windows store app. i'm trying to launch a messagedialog when one of the command buttons inside another messagedialog is clicked. the point of this is to warn the user that their content ... c#lambdamodal-dialogwindows-store-appsasync-await roryok 9,655 asked dec 15, 2013 at 10:27","['c#', 'lambda', 'modal-dialog', 'windows-store-apps', 'async-await']",en,await operator used within sync lambda expression got c windows store app trying launch messagedialog one command buttons inside another messagedialog clicked point warn user content clambdamodaldialogwindowsstoreappsasyncawait rook asked dec
559"wasapi capture shared event driven mode in windows server 2016 and below i am building an application to capture audio from the device using wasapi where all the api used support windows vista and above devices. initially, i captured audio from the device with wasapi ... sharedevent-drivenwasapiaudio-capture preethi ravi 165 asked sep 15, 2023 at 13:15","['shared', 'event-driven', 'wasapi', 'audio-capture']",en,wasp capture shared event driven mode windows server building application capture audio device using wasp api used support windows vista devices initially captured audio device wasp sharedeventdrivenwasapiaudiocapture preethi ravi asked sep
560is there a way to configure a server to prevent php typo ($i without $i++) infinite loops from happening? is there a way to configure a server or in php settings to prevent php for loop typo ($i without $i++) infinite loops from happening? specifically prevent this (sleep-deprived) typo from causing ... php ina 19.6k asked 2 days ago,['php'],en,way configure server prevent php typo without infinite loops happening way configure server php settings prevent php loop typo without infinite loops happening specifically prevent sleepdeprived typo causing php ina k asked days ago
561"how to validate password and confirm password in react-hook-form version 7 i am using react-form-hook. i am trying to match the password and confirm the password. but it is not working and validation not get triggered. this is the password input react-form-hook. <div ... javascriptreactjsreact-hook-form tamal mallick 99 asked may 1, 2022 at 6:29","['javascript', 'reactjs', 'react-hook-form']",en,validate password confirm password reacthookform version using reactformhook trying match password confirm password working validation get triggered password input reactformhook div javascriptreactjsreacthookform tamil gallica asked may
562"twilio function works for inbound calls but not outbound calls? i have created a function in twilio that essentially allows for a back-and-forth conversation with a voice chatbot using openai. it basically listens to each response, transcribes it, passes it to ... twilioopenai-apichatgpt-apitwilio-studiotwilio-functions jeff winkle 1 asked mar 15, 2024 at 20:08","['twilio', 'openai-api', 'chatgpt-api', 'twilio-studio', 'twilio-functions']",en,twilio function works inbound calls outbound calls created function twilio essentially allows backandforth conversation voice chariot using open basically listens response transcribed passes twilioopenaiapichatgptapitwiliostudiotwiliofunctions jeff twinkle asked mar
563"content picker restrict content types i am creating custom layout elements and one of the elements includes a content picker that can only include certain element types (such as page and blogpost). i am able to add the content picker, but ... orchardcmsorchardcms-1.10 wentz 700 asked 1 hour ago","['orchardcms', 'orchardcms-1.10']",en,content picked restrict content types creating custom layout elements one elements includes content picked include certain element types page blogpost able add content picked orchardcmsorchardcms went asked hour ago
564"where to manage access to an aggregate? following domain-driven-design rules following the domain-driven-design principals, let's say we are building b2b order management system. one of the requirement is that for each customer/order/order item we should be able to assign ... c#domain-driven-design georgekarlinzer 618 asked 2 days ago","['c#', 'domain-driven-design']",en,manage access aggregate following domaindrivendesign rules following domaindrivendesign principals let us say building bb order management system one requirement customerorderorder item able assign cdomaindrivendesign georgekarlinzer asked days ago
565"how to obfuscate an oauth fetch request credentials as much as possible? disclaimer : this is a conceptual/design question, but please i hope that the community will be open minded enough to let me post it, i've been struggling with this idea for a long time myself, and ... javascriptsecurityoauthclientcredentials segfault 75 asked aug 26, 2023 at 1:23","['javascript', 'security', 'oauth', 'client', 'credentials']",en,obfuscate oath fetch request credentials much possible disclaimer conceptualdesign question please hope community open minded enough let post struggling idea long time javascriptsecurityoauthclientcredentials default asked aug
566"delphi - firedac update mysql table (blob) with dynamic array of bytes (tbytes) i would like to update a column in a mysql table, which is a blob type, with a dynamic array of bytes (tbytes) using delphi. i can't find any example or documentation that explains how to assign ... arraysdelphiblobmysql-connectorfiredac bluscape 373 asked mar 5, 2024 at 20:04","['arrays', 'delphi', 'blob', 'mysql-connector', 'firedac']",en,delhi fired update table blob dynamic array bytes bytes would like update column table blob type dynamic array bytes bytes using delhi cannot find example documentation explains assign arraysdelphiblobmysqlconnectorfiredac bluscape asked mar
567"bash losing string escapes when piping i have a program a that produces a stream of json documents where some of the fields contain strings with escaped double-quotes. this json is then piped into a bash script b which invokes jq to do ... bashpipeescaping rookie099 2,637 asked jan 29, 2024 at 21:00","['bash', 'pipe', 'escaping']",en,bash losing string escapes piping program produces stream son documents fields contain strings escaped doublequotes son piped bash script b invokes jq bashpipeescaping rookie asked jan
568"how to create a label for a react native switch component? usually you can use the label html element to add labels for web apps. how can you achieve this result in react native? here is the react native switch component i'm using: https://reactnative.dev/... cssreact-native chackerian 1,411 asked feb 25, 2023 at 6:39","['css', 'react-native']",en,create label react native switch component usually use label html element add labels web apps achieve result react native react native switch component using cssreactnative chackerian asked feb
569"salesforce lwc remove element from array with a button click i am trying to remove an element from a dynamic array. its an object type array and i want to delete the element with the object name field. the array is being shown with an iterate in lightning web ... componentssalesforce-lightninglwclightning hasan zubairi 1,183 asked nov 10, 2023 at 4:55","['components', 'salesforce-lightning', 'lwc', 'lightning']",en,salesforce loc remove element array button click trying remove element dynamic array object type array want delete element object name field array shown literate lightning web componentssalesforcelightninglwclightning hasan zubairi asked nov
570"how to make routing work in nuxt3 when deployed to azure static web app i have deployed my application to azure static web app and everything works great if i start form the route domain (ie, test.com) and navigate to test.com/shop from button links. however, if i start ... javascriptazurevuejs3nuxt3.jsazure-static-web-app qiuzman 1,777 asked oct 5, 2023 at 2:30","['javascript', 'azure', 'vuejs3', 'nuxt3.js', 'azure-static-web-app']",en,make routing work next deployed azure static web app deployed application azure static web app everything works great start form route domain ie testcom navigate testcomshop button links however start javascriptazurevuejsnextazurestaticwebapp qiuzman asked oct
571"how to properly highlight typescript compiler error messages with pygments for example, the following code leads to a compilation error: const a: number = ''; error message is: a.ts:1:7 - error ts2322: type 'string' is not assignable to type 'number'. 1 const a: number = ''... typescriptpygments xuhdev 9,440 asked jun 20, 2024 at 22:38","['typescript', 'pygments']",en,properly highlight typescript compiler error messages pigments example following code leads compilation error const number error message ats error ts type string assignable type number const number typescriptpygments xuhdev asked jun
572"installing laravel breeze ps d:\student-dashboard> composer require laravel/breeze --dev ./composer.json has been updated running composer update laravel/breeze loading composer repositories with package information ... laravelcomposer-phpbreeze sasanka vitharana 1 asked apr 17, 2023 at 10:21","['laravel', 'composer-php', 'breeze']",en,installing travel breeze ps dstudentdashboard composer require travelbreeze dev composerson updated running composer update travelbreeze loading composer repositories package information laravelcomposerphpbreeze savanna vitharana asked apr
573"nginx subdirectory wordpress and symfony application i want to run both wordpress and symfony instances in my nginx configuration. symfony and wordpress are located as subdirectories of my root directory: symfony: /var/www/mysite/pm/public wordpress: /... phpwordpresssymfonynginx kekw 400 asked oct 9, 2023 at 6:57","['php', 'wordpress', 'symfony', 'nginx']",en,engine subdirectory wordpress symphony application want run wordpress symphony instances engine configuration symphony wordpress located subdirectories root directory symphony varwwwsitepmpublic wordpress phpwordpresssymfonynginx kew asked oct
574"mongodb nested object lookup i want to reach each subhobbies in hobbies schema but i cant figure it out how to do it properly. can anyone help me with this? { $lookup: { from: ""hobbies"", let: { vid: &... mongodbmongoosemongodb-queryaggregation-framework notcan 35 asked mar 21, 2024 at 14:29","['mongodb', 'mongoose', 'mongodb-query', 'aggregation-framework']",en,mongodb nested object lookup want reach subhobbies hobbies schema cannot figure properly anyone help lookup hobbies let vid mongodbmongoosemongodbqueryaggregationframework notion asked mar
575"razor pages _layout.cshtml, and strongly typed partial pages there are a lot of similar questions, but no good answers. this is my attempt: i want to use a partial view in _layout.cshtml for a menu that will appear on every page. my _layout.cshtml: <div id=&... c#asp.net-corerazorrazor-pages novadev 2,961 asked jun 22, 2023 at 17:37","['c#', 'asp.net-core', 'razor', 'razor-pages']",en,razor pages layouthtml strongly typed partial pages lot similar questions good answers attempt want use partial view layouthtml menu appear every page layouthtml div id caspnetcorerazorrazorpages novadev asked jun
576"endpoint(router) available for authenticated user or not fastapi today i have a question that i tried to solve myself, and looked around the internet with no success. in a fastapi website. while the user is not logged in, they can navigate to any page. but if ... pythonfastapijinja2-cli delivery-ti 1 asked apr 18 at 23:20","['python', 'fastapi', 'jinja2-cli']",en,endpointrouter available authenticated user fastapi today question tried solve looked around internet success fastapi website user logged navigate page pythonfastapijinjacli deliveryti asked apr
577"git - how git merge works i am trying to learn about git merge and i am facing a merge conflict. here is my branch structure: i am modifying and tracking just one file file.txt. at commit c, this is the content of the file is ... gitmergemerge-conflict-resolutionmerge-conflict dumbcoder 475 asked oct 13, 2023 at 13:15","['git', 'merge', 'merge-conflict-resolution', 'merge-conflict']",en,git git merge works trying learn git merge facing merge conflict branch structure modifying tracking one file filetxt commit c content file gitmergemergeconflictresolutionmergeconflict dumbcoder asked oct
578"how to determine the file extension of a file from a uri assuming i am given a uri, and i want to find the file extension of the file that is returned, what do i have to do in java. for example the file at http://www.daml.org/2001/08/baseball/baseball-ont ... javaurlfileuri ankur 51.2k asked jul 13, 2010 at 3:57","['java', 'url', 'file', 'uri']",en,determine file extension file uri assuming given uri want find file extension file returned java example file httpwwwdamorgbaseballbaseballont javaurlfileuri anger k asked jul
579"how to select a video from the gallery and get it's real path? i can open the gallery with this code, intent intent = new intent(intent.action_pick); intent.settype(""video/*""); intent.setaction(intent.action_get_content); startactivityforresult(... androidandroid-gallery prashant 1,613 asked jun 25, 2015 at 8:04","['android', 'android-gallery']",en,select video gallery get real path open gallery code intent intent new intentintentactionpick intentsettlevideo intentsectionintentactiongetcontent startactivityforresult androidandroidgallery peasant asked jun
580"select into using union query i want to create a new table in sql server with the following query. i am unable to understand why this query doesn't work. query1: works select * from table1 union select * from table2 query2: ... sqlsql-servert-sqlunionderived-table sekhar 5,847 asked oct 25, 2010 at 20:46","['sql', 'sql-server', 't-sql', 'union', 'derived-table']",en,select using union query want create new table sql server following query unable understand query work query works select table union select table query sqlsqlserversqlunionderivedtable shear asked oct
581"scraping class for ask prices: retrieving incomplete ask-light values here's my problem. i'm attempting to retrieve various values (prices) from the binance website. i've managed to extract different classes from the 'orderbook-list-container'. however, it doesn't give ... pythonselenium-webdriverweb-scraping look_thisstreaming 25 asked apr 18, 2024 at 18:57","['python', 'selenium-webdriver', 'web-scraping']",en,scraping class ask prices retrieving incomplete asklight values problem attempting retrieve various values prices finance website managed extract different classes orderbooklistcontainer however give pythonseleniumwebdriverwebscraping lookthisstreaming asked apr
582"websocket/http, which protocol used by c++ socket type by default and how it works herer? i am learning c++ to understand the basics and internals of networking, how system works. for that i was following a tutorial for building chat application. here is the code: chatserver #include <... c++socketsnetwork-programming himanshu singh 1,953 asked jan 27, 2024 at 19:06","['c++', 'sockets', 'network-programming']",en,websockethttp protocol used c socket type default works learning c understand basics internal networking system works following tutorial building chat application code chatserver include csocketsnetworkprogramming himanshu singh asked jan
583"azure serverless functions without flask server in python in aws lambda a serverless function is a small piece of code hosted somewhere. i can curl a url to run the code. in a python function app v4, i seem to be forced to use a server. is it possible to get ... azureazure-functions r89 13 asked jan 13, 2024 at 10:52","['azure', 'azure-functions']",en,azure serverless functions without flask server python aws lambda serverless function small piece code hosted somewhere curl url run code python function app v seem forced use server possible get azureazurefunctions r asked jan
584"jmeter: in jp@gc webdriver sampler, how to launch the chrome browser in incognito mode using jp@gc webdriver sampler, i am trying to get the microsoft ad user oauth2.0 authorization code. i need to launch the browser in incognito mode in order make sure that is does not use my sso ... jmeterincognito-mode nandini b.v 15 asked jan 25, 2024 at 18:37","['jmeter', 'incognito-mode']",en,meter jpgc webdriver sampler launch chrome browser incognito mode using jpgc webdriver sampler trying get microsoft ad user oath authorization code need launch browser incognito mode order make sure use sso jmeterincognitomode landing bv asked jan
585"basic if then else failure i have an issue with enabling the motion drive by updating the control power via plc write. i have followed the learn infosys tuturial for motion and it seems i have a different result than the video. ... if-statementtwincat wes ellgass 101 asked apr 16, 2024 at 15:06","['if-statement', 'twincat']",en,basic else failure issue enabling motion drive updating control power via plc write followed learn informs tutorial motion seems different result video ifstatementtwincat wes elegans asked apr
586"change title and colorbar text and tick colors i wanted to know how to change the color of the ticks in the colorbar and how to change the font color of the title and colorbar in a figure. for example, things obviously are visible in temp.png but ... pythonmatplotlib ahmadh 1,652 asked mar 12, 2012 at 7:10","['python', 'matplotlib']",en,change title colorbar text tick colors wanted know change color ticks colorbar change font color title colorbar figure example things obviously visible temppng pythonmatplotlib ahmad asked mar
587"can i display the .net maui composed appicon in a specific (non-default) position? i'm just migrating an app from xamarin to .net maui. i have no problem displaying ""images"" anywhere i like at a specific requested size etc. however, i would like to display the default ... .netmauiappicon ade 118 asked nov 12, 2023 at 14:15","['.net', 'maui', 'appicon']",en,display net mai composed appicon specific nondefault position migrating app marin net mai problem displaying images anywhere like specific requested size etc however would like display default netmauiappicon ade asked nov
588"how to change parent css such as <mat-menu> from a standalone component without leaking the css to the global style? my goal is to edit <mat-menu> css that i use in an angular standalone component. what i've tried: use :ng-deep. however, this cause the css to leak to the global style, which is not desirable. ... cssangularng-deep jason rich darmawan 2,121 asked jan 31, 2024 at 11:29","['css', 'angular', 'ng-deep']",en,change parent css standalone component without leaking css global style goal edit css use angular standalone component tried use ngdeep however css leak global style desirable cssangularngdeep jason rich darmawan asked jan
589"how to create custom overlapped carousel slider in flutter? i want to make a slider like the picture below: i checked almost all pub.dev packages. especially packages overlapped_carousel and carousel_slider. the problem with package overlapped_carousel is ... fluttersliderslideshowcarousel-slider javad.tt 63 asked may 31, 2024 at 22:33","['flutter', 'slider', 'slideshow', 'carousel-slider']",en,create custom overlapped carousel slider clutter want make slider like picture checked almost pubdev packages especially packages overlappedcarousel carouselslider problem package overlappedcarousel fluttersliderslideshowcarouselslider javatt asked may
590"how to populate a javafx textfield upon redirection using a controller whenever i try to call the gotopage method, i get the following exception. before using the controller, i was just literally calling the non static settextfield method using that method's class, but i ... javajavafxjavafx-8 chandler garry 1 asked jan 25, 2024 at 17:26","['java', 'javafx', 'javafx-8']",en,populate java textfield upon redirection using controller whenever try call gotopage method get following exception using controller literally calling non static settextfield method using methods class javajavafxjavafx chandler carry asked jan
591"how can i wait for all kubernetes pods to be 2/2 and status to be in running stage? i am writing a shell script in which i need to wait for all the pods to be in 2/2 and be in running stage before proceeding further. there are around seven pods in the namespace. how can i achieve ... bashkubernetes prathik 1 asked jun 22, 2023 at 13:58","['bash', 'kubernetes']",en,wait kubernetes pods status running stage writing script need wait pods running stage proceeding around seven pods namespace achieve bashkubernetes prathik asked jun
592"where do i place ""getdistancetravelled();""? [closed] i need to extract the distance travelled in each run or the total distance travelled in the 10,000 runs. i thought of using <getdistancetravelled();> . but i am not placing it right and i don't ... anylogic alan jaison 1 asked 2 days ago",['anylogic'],en,place getdistancetravelled closed need extract distance travelled run total distance travelled runs thought using placing right anylogic alan jason asked days ago
593"downscaling aws rds aurora-mysql instances we use terraform to manage aws resources. i recently downscaled rds aurora-mysql8 cluster (one reader, one writer in different az) from r5 to t3 instances. i try to figure out from aws event logs ... amazon-web-servicesamazon-rdsamazon-aurorafailover lekso 1,823 asked 21 hours ago","['amazon-web-services', 'amazon-rds', 'amazon-aurora', 'failover']",en,downscaling aws rds auroramyself instances use terraform manage aws resources recently downscaled rds auroramyself cluster one reader one writer different az r instances try figure aws event logs amazonwebservicesamazonrdsamazonaurorafailover least asked hours ago
594"passing locale to sort strings alphabetically i have a list of strings that i would like to sort alphabetically, depending on the user's locale. to do this i use collator: val collator = collator.getinstance() return collator.compare(stringone, ... javakotlincollator сергей беляков 511 asked oct 24, 2023 at 15:17","['java', 'kotlin', 'collator']",en,passing locale sort strings alphabetically list strings would like sort alphabetically depending users locale use collector val collector collectorgetinstance return collectorcomparestringent javakotlincollator sergei beliakov asked oct
595"try-catch exception problem, not working a whole exception this exception work it, to the half, for searching is ok, but from ""catch"" doesn't pop up a message- ""error in searching"", and nothing happen when i type a wrong word which is not ... c#windowsformsexceptiontry-catch nik-trifonov 1 asked jan 26, 2024 at 7:33","['c#', 'windows', 'forms', 'exception', 'try-catch']",en,trycatch exception problem working whole exception exception work half searching ok catch pop message error searching nothing happen type wrong word cwindowsformsexceptiontrycatch niktrifonov asked jan
596"the provided token is malformed or otherwise invalid latestall s3 bucket file is displayed, but when i upload file then error is generate. i have arn and instance profile. use aws\credentials\credentialprovider; use aws\credentials\... phpamazon-web-servicesamazon-s3aws-sdkamazon-iam wo developers 333 asked jun 11, 2019 at 11:01","['php', 'amazon-web-services', 'amazon-s3', 'aws-sdk', 'amazon-iam']",en,provided token malformed otherwise invalid latestall bucket file displayed upload file error generate arn instance profile use awscredentialscredentialprovider use awscredentials phpamazonwebservicesamazonsawssdkamazoniam wo developers asked jun
597"spaceship operator for type representing a compile-time constant std::string_view [duplicate] i have a class that represents a compile-time constant string. i'd like it to act like a string in that it has an implicit operator std::string_view() const noexcept { return ""foo""; }. i'd ... c++c++20 ben 9,783 asked feb 12, 2024 at 13:28","['c++', 'c++20']",en,spaceship operator type representing compiletime constant stdstringview duplicate class represents compiletime constant string would like act like string implicit operator stdstringview const except return foo would cc ben asked feb
598"android don't know how to play youtube urls by using exoplayer i get default youtube url from user like this ""https://www.youtube.com/watch?v=dqw4w9wgxcq"" and i need to play it, but exoplayer can't read it. i need to somehow extract it. i tried doing it ... androidurlyoutubeextractexoplayer gayorgy 13 asked jul 5, 2023 at 15:46","['android', 'url', 'youtube', 'extract', 'exoplayer']",en,android know play youtube urls using exoplanet get default youtube url user like need play exoplanet cannot read need somehow extract tried androidurlyoutubeextractexoplayer gayorgy asked jul
599"is there a way to move images and resize them in the cmd with imagemagick? [closed] i put this prompt into the cmd: ""original patrols\badger.jpg"" -resize 50% ""small patrols/badger.jpg"" it didn't work. why? i tried to fix it multiple times, but it failed. i think ... cmdimagemagickcommand-prompt tom e 7 asked yesterday","['cmd', 'imagemagick', 'command-prompt']",en,way move images resize cmd imagemagick closed put prompt cmd original patrolsbadgerjpg resize small patrolsbadgerjpg work tried fix multiple times failed think cmdimagemagickcommandprompt tom e asked yesterday
600"i am trying to display two columns within a row in my ionic/angular project. the its just creating a stack where the other content is in the bottom i am trying to display two columns within a row in my ionic/angular project. the its just creating a stack where the other content is in the bottom. this is also my css <ion-grid class=""... htmlcssangularionic-frameworkgrid coderistic 11 asked feb 16, 2024 at 12:54","['html', 'css', 'angular', 'ionic-framework', 'grid']",en,trying display two columns within row ionicangular project creating stack content bottom trying display two columns within row ionicangular project creating stack content bottom also css iongrid class htmlcssangularionicframeworkgrid coderistic asked feb
601"keep showing error message in formik field select and yup validation i am trying to use formik and yup valiation first time, i have created a select field and have put some options , after selecting the option everytime it keep showing the validation error message , ... reactjsformikyup tintin 183 asked oct 12, 2023 at 7:44","['reactjs', 'formik', 'yup']",en,keep showing error message format field select yup validation trying use format yup variation first time created select field put options selecting option overtime keep showing validation error message reactjsformikyup titan asked oct
602"soap ws return error classnotfoundexception: javax.servlet.http.httpservlet im in dire need of help. i planned on upgrading my soap webservice running on tomcat 8.5 with jdk 8 to the latest version. this might not be a useful information but previously i used netbeans 8.2. my ... xmlweb-servicestomcatjava-21 mace 167 asked jan 10, 2024 at 17:33","['xml', 'web-services', 'tomcat', 'java-21']",en,soap ws return error classnotfoundexception javaservlethttp dire need help planned upgrading soap webservice running combat kidding latest version might useful information previously used netbeans tolwebservicestomcatjava mace asked jan
603"vs code unable to format c# file using .editorconfig, `format document` doesn't seem to work i have a c# project with vs code, having ms-dotnettools.csharp and editorconfig.editorconfig extensions (among others). as per this post i installed npm install -g editorconfig. my .editorconfig file ... c#visual-studio-codeomnisharpeditorconfig hung p.t. 141 asked apr 21, 2023 at 5:24","['c#', 'visual-studio-code', 'omnisharp', 'editorconfig']",en,vs code unable format c file using editorconfig format document seem work c project vs code msdotnettoolssharp editorconfigeditorconfig extensions among others per post installed num install g editorconfig editorconfig file cvisualstudiocodeomnisharpeditorconfig hung pt asked apr
604"error: extension context invalidated, from chrome-extension://haldlgldplgnggkjaafhelgiaglafanh/admin.js according to sentry, our react application has reported this error 700 times in the last 24 hours, from 2 users: error: extension context invalidated. at object._updatemetadata(chrome-extension://... javascriptgoogle-chrome-extensionerror-handlingsentry canovice 10.5k asked jan 10, 2023 at 16:34","['javascript', 'google-chrome-extension', 'error-handling', 'sentry']",en,error extension context invalidated chromeextensionhaldlgldplgnggkjaafhelgiaglafanhadminjs according sentry react application reported error times last hours users error extension context invalidated objectupdatemetadatachromeextension javascriptgooglechromeextensionerrorhandlingsentry novice k asked jan
605"unity player won't jump sometimes i am following this tutorial for reference, particularly at 4:03:34. my issue is that my player wont jump sometimes when i hit the space bar. it seems to be working just fine for the dude in the ... c#unity-game-engine shane amare 79 asked jul 5, 2023 at 15:25","['c#', 'unity-game-engine']",en,unity player jump sometimes following tutorial reference particularly issue player jump sometimes hit space bar seems working fine dude cunitygameengine shane aware asked jul
606"what are some use cases for static methods and properties in classes? powershell classes can contain static methods and properties: class stack { [string] $name [datetime] static $date = (get-date) stack($name) { $this.name = $name } ... powershell blaisem 657 asked feb 21, 2022 at 10:43",['powershell'],en,use cases static methods properties classes powershell classes contain static methods properties class stack string name daytime static date getdate stackname thisname name powershell blaisem asked feb
607"frontend redirection to sso form via microservice + keycloak in my project, the frontend for authentication does not go to keycloak directly: first it makes a request to the spring boot microservice, which in turn must request the desired keycloak realm. ... spring-bootauthenticationkeycloaksingle-sign-on pickstar 43 asked mar 11, 2024 at 12:33","['spring-boot', 'authentication', 'keycloak', 'single-sign-on']",en,frontend redirection sso form via microservice keycloak project frontend authentication go keycloak directly first makes request spring boot microservice turn must request desired keycloak realm springbootauthenticationkeycloaksinglesignon rockstar asked mar
608"inno setup cannot find needed node msi file during installation (windows) [duplicate] took over this innosetup script from a guy which just quit. very close to making it work. it creates the install file but it fails finding the node.msi and nssm.exe files during installation. part of ... inno-setup terje nygård 1,257 asked feb 1, 2024 at 16:27",['inno-setup'],en,setup cannot find needed node msi file installation windows duplicate took innosetup script guy quit close making work creates install file fails finding nodemsi ssmexe files installation part intosetup terre ngard asked feb
609"langchain exceed output token limits i've read there are ways to exceed token limitations for inputs. these are the following methods: stuff, map reduce, refine, map rerank. in my context, i want to produce a large json document. the ... pythonopenai-apipy-langchain notaphoenix 166 asked may 9, 2023 at 21:17","['python', 'openai-api', 'py-langchain']",en,langchain exceed output token limits read ways exceed token limitations inputs following methods stuff map reduce refine map rank context want produce large son document pythonopenaiapplylangchain notaphoenix asked may
610"udf returning ljava.lang.object;@ i have a pyspark udf which when i try to apply to each row for one of the df columns and get a new column, i get a [ljava.lang.object;@7e44638d (different value after the @ for each row) please see ... pythonapache-sparkuser-defined-functions mariat 73 asked 2 days ago","['python', 'apache-spark', 'user-defined-functions']",en,df returning lavalangobject spark df try apply row one df columns get new column get lavalangobjected different value row please see pythonapachesparkuserdefinedfunctions maria asked days ago
611"restore the source database changes using rman incremental backup in oracle 19c where target database also changes need to upgrade the oracle database from 12c to 19c in different servers using rman backup and restore method. db size is approx. 10tb and increasing on a daily basis. below would be the steps: ... oracle12cdatabase-backupsoracle19cdatabase-restorerman sangi dan paliwal 13 asked aug 4, 2023 at 6:40","['oracle12c', 'database-backups', 'oracle19c', 'database-restore', 'rman']",en,restore source database changes using man incremental backup oracle c target database also changes need upgrade oracle database c c different servers using man backup restore method db size approx tb increasing daily basis would steps oracledatabasebackupsoracledatabaserestorerman sang dan palatal asked aug
612"apiclient.requestjwtusertoken of com.docusign.esign.client in java 21 apiclient.requestjwtusertoken of com.docusign.esign.client after upgrading java 8 to java 21 and springboot version 3.2.5 got below error for apiclient.requestjwtusertoken **servlet.service() for ... docusignapidocusign-sdk tech div 11 asked jun 20, 2024 at 14:52","['docusignapi', 'docusign-sdk']",en,apiclientrequestjwtusertoken comfocusingdesignclient java apiclientrequestjwtusertoken comfocusingdesignclient upgrading java java springboot version got error apiclientrequestjwtusertoken servletservice docusignapidocusignsdk tech div asked jun
613"need help understaning how to use #include with multiple files [duplicate] #include file ""c:\users\sampo\projects\calculator_functions.cpp"" includes itself. i'm new to multiple files, so it's all a little confusing, being new to c++ as well. calculator.cpp /* 1st ... c++ sam 1 asked mar 13, 2024 at 2:03",['c++'],en,need help understanding use include multiple files duplicate include file cuserssampprojectscalculatorfunctionscpp includes new multiple files little confusing new c well calculatorcpp st c sam asked mar
614"pg_dump transaction isolation level error i'm having a hard time finding a reason/solution for this error. i'm hoping someone else has seen this and has some direction. these commands have been successful in the past from this same host. i'... postgresqlpg-dumptransaction-isolation zelda2 1 asked sep 27, 2023 at 12:57","['postgresql', 'pg-dump', 'transaction-isolation']",en,pgdump transaction isolation level error hard time finding reasonsolution error hoping someone else seen direction commands successful past host postgresqlpgdumptransactionisolation zelda asked sep
615"why does a redis gears funcion fail with ""operation not permitted"" when it writes data to another shard? (i posted this issue to redisgears github repo too.) i created a very simple redis gears function as follows. def failed_function(x): execute('set', 'a', 'somevalue') gearsbuilder('keysreader'... redisredis-clusterredisgears weijia song 183 asked mar 8, 2024 at 7:41","['redis', 'redis-cluster', 'redisgears']",en,redir gears function fail operation permitted writes data another hard posted issue redisgears github repo created simple redir gears function follows def failedfunctionx executeset somevalue gearsbuildernewsreader redisredisclusterredisgears wikia song asked mar
616"how to reduce time spent acquring jdbc connection? this is a springboot v2 application, by default hikari is used for data source creation. we're trying to perform load testing with 200 users simulated firing a single endpoint for 1 minute. during the ... javapostgresqlspring-boothikaricp tommy leong 3,030 asked jul 30, 2024 at 17:20","['java', 'postgresql', 'spring-boot', 'hikaricp']",en,reduce time spent acquiring jbc connection springboot v application default idari used data source creation trying perform load testing users simulated firing single endpoint minute javapostgresqlspringboothikaricp tommy long asked jul
617"error when trying to run java 17 - spring boot 3 project with ehcache using graalvm native image i'm trying to run an app with java 17 and spring boot 3 using graalvm native image support. it's a very simple app with just a get endpoint. the app uses ehcache and spring boot cache to cache the ... javaspring-bootehcachegraalvm john dillard 11 asked jan 22, 2023 at 15:16","['java', 'spring-boot', 'ehcache', 'graalvm']",en,error trying run java spring boot project cache using graalvm native image trying run app java spring boot using graalvm native image support simple app get endpoint app uses cache spring boot cache cache javaspringbootehcachegraalvm john dollar asked jan
618"login test always returns empty optional (spring boot) i´m making a test for a very simple service login method, but i always get an empty optional, when i should recieve an object. i´ve tried eevery part of the test, the ""when""s are working as ... javaspring-boottestingmockitoassertj zeke cachi 65 asked jan 30, 2024 at 15:34","['java', 'spring-boot', 'testing', 'mockito', 'assertj']",en,login test always returns empty optional spring boot im making test simple service login method always get empty optional receive object ive tried every part test whens working javaspringboottestingmockitoassertj zee cache asked jan
619"register image onto a smaller, partial, image but with some common features i want to transform images of written text (taken by a mobile phone camera with different 3d rotation, scale etc.) so that they look ""orthogonal"" (by this i mean as if you read them from a ... pythonopencvimage-processingcomputer-visionaffinetransform bliako 1,152 asked jan 16, 2024 at 15:29","['python', 'opencv', 'image-processing', 'computer-vision', 'affinetransform']",en,register image onto smaller partial image common features want transform images written text taken mobile phone camera different rotation scale etc look orthogonal mean read pythonopencvimageprocessingcomputervisionaffinetransform blake asked jan
620"why is my new ddev drupal 10 project failing to start? i have many ddev projects on my mac. this is the first where i'm starting a new drupal 10 project rather than upgrading a drupal 9 site. i clone the pantheon repo cd to the repo composer install ddev ... ddev jayengreen 1,445 asked jul 26, 2023 at 22:04",['ddev'],en,new dev drupal project failing start many dev projects mac first starting new drupal project rather upgrading drupal site clone pantheon repo cd repo composer install dev dev jayengreen asked jul
621"what is java 21s new sequence interface what is the new sequence interface in java 21? what does it add and what may be common issues to consider? javacollectionsinterfacejava-21 a_arnold 4,129 asked aug 9, 2023 at 4:16","['java', 'collections', 'interface', 'java-21']",en,java new sequence interface new sequence interface java add may common issues consider javacollectionsinterfacejava aarnold asked aug
622"azure devops pull-request conflict on complete probably this is for a lot of users, a simple question, but i can't figure it out right now. situation, in azure devops git repositories we have multiple branches: master (main development) ... gitazureazure-devopspull-requestgit-merge-conflict michiel van vaardegem 2,045 asked feb 7, 2023 at 11:53","['git', 'azure', 'azure-devops', 'pull-request', 'git-merge-conflict']",en,azure drops pullrequest conflict complete probably lot users simple question cannot figure right situation azure drops git repositories multiple branches master main development gitazureazuredevopspullrequestgitmergeconflict michael van vaardegem asked feb
623"how to judge a torch.tensor dtype is int or not? i want to check a tensor convert from an image is normalized or not, i.e. the dtype is int or float. is there convenient way to achieve this goal? i do not want an enumerated condition check like a.... pytorch whisht 763 asked may 16, 2022 at 1:50",['pytorch'],en,judge torchtensor type int want check tensor convert image normalized ie type int float convenient way achieve goal want enumerated condition check like pwtorch asked may
624"how to emit an interface with properties? i would like to use a typebuilder to create an interface with some properties. i'm trying to modify the accepted solution from the how to dynamically create a class question. here's a sample of the ... c#reflection brian wheatley 13 asked feb 4, 2024 at 14:15","['c#', 'reflection']",en,emit interface properties would like use typebuilder create interface properties trying modify accepted solution dynamically create class question sample creflection brian wheatley asked feb
625"angular signals inside effect() in a component, i am accessing item_id as input parameter. where can i call tosignal() or .subscribe() to service method, if it is not allowed inside constructor / ngoninit() effect()? item_id = ... angularrxjssignalsangular-signals nevyan dimitrov neykov 49 asked jul 19, 2024 at 11:21","['angular', 'rxjs', 'signals', 'angular-signals']",en,angular signals inside effect component accessing itemid input parameter call signal subscribe service method allowed inside constructor ngoninit effect itemid angularrxjssignalsangularsignals newman dimitrov neykov asked jul
626"issues with vertical stretching and horizontal movement in metal shading language ray tracing shader i'm currently learning metal shading language and have been experimenting with a custom shader for ray tracing. the shader compiles and runs without errors, but i've encountered two issues that seem ... shaderscenekitmetalfragment-shadermetalkit arthur tl 31 asked feb 19, 2024 at 7:16","['shader', 'scenekit', 'metal', 'fragment-shader', 'metalkit']",en,issues vertical stretching horizontal movement metal shading language ray tracing shade currently learning metal shading language experimenting custom shade ray tracing shade compiles runs without errors encountered two issues seem shaderscenekitmetalfragmentshadermetalkit arthur tl asked feb
627"how to search using company name with the search for users (v2) connector how can i search by company name using search for users(v2) connector, the search term does not allow search by name, also the default limit is 1000 how to increase limit for record? it says search ... power-automate user2021837 105 asked oct 11, 2023 at 0:55",['power-automate'],en,search using company name search users v connector search company name using search usersv connector search term allow search name also default limit increase limit record says search powerautomate user asked oct
628"how to handle timezone conversion for timestamps from questdb in javascript (react)? [closed] i'm working with questdb in a javascript (react) environment and facing an issue with timestamp values. when the client's browser reads these timestamp values, they are automatically converted to the ... javascripttimezonequestdb javier ramirez 4,095 asked jan 11, 2024 at 13:15","['javascript', 'timezone', 'questdb']",en,handle timezone conversion timestamp quest javascript react closed working quest javascript react environment facing issue timestamp values clients browser reads timestamp values automatically converted javascripttimezonequestdb javier ramirez asked jan
629"remove the woocommerce slider and simply display the images (variable product) i use the ""woocommerce additional variation images"" plugin to add additional images to my variable products. i also use ""product variation swatches for woocommerce (pro)"" to give ... woocommercesliderproduct-variations steven etienne 1 asked oct 5, 2023 at 16:19","['woocommerce', 'slider', 'product-variations']",en,remove woocommerce slider simply display images variable product use woocommerce additional variation images plugin add additional images variable products also use product variation watches woocommerce pro give woocommercesliderproductvariations steven tienne asked oct
630"prismaclientinitializationerror: can't reach database server i'm unable to get the site running and connect to the database. i keep getting this error whenever i do npm run dev. i have even attempted to set connect_timeout to 1 and pool_timeout to 0, pgbouncer ... reactjspostgresqlnext.jsprismavercel ahmed b 33 asked jul 24, 2024 at 10:50","['reactjs', 'postgresql', 'next.js', 'prisma', 'vercel']",en,prismaclientinitializationerror cannot reach database server unable get site running connect database keep getting error whenever num run dev even attempted set connecttimeout pooltimeout bouncer reactjspostgresqlnextjsprismavercel ahmed b asked jul
631"black screen when pressing a button on a bottom sheet this is a simple contacts application that is used to create edit and delete data. it is also used to search contacts from this application. the issue that i'm facing is that whenever i create or ... androidiphonefluttermobile zain ahamed 13 asked dec 10, 2023 at 12:45","['android', 'iphone', 'flutter', 'mobile']",en,black screen pressing button bottom sheet simple contacts application used create edit delete data also used search contacts application issue facing whenever create androidiphonefluttermobile main ashamed asked dec
632"vitejs doesnt compile scss and js item with the same name i work with drupal and twig components. for instance, i have a button component that consists of the following files within the 'button' folder: button.twig, button.js, and button.scss. now, i want to ... javascriptsassdrupalvite yustintr 11 asked feb 13, 2024 at 10:44","['javascript', 'sass', 'drupal', 'vite']",en,votes compile css js item name work drupal twig components instance button component consists following files within button folder buttontwig buttonjs buttoncss want javascriptsassdrupalvite yustintr asked feb
633hangfire autofac job can't resolve dbcontext: componentnotregisteredexception in backgroundscope i'm working on a .net framework 4.6.1 application using autofac (5.2.0) for dependency injection and hangfire for background jobs. i have a service class storedatacleanupservice that depends on an ef ... asp.netentity-framework-6autofacbackground-processhangfire ashish 25 asked apr 19 at 10:39,"['asp.net', 'entity-framework-6', 'autofac', 'background-process', 'hangfire']",en,hangfire autofac job cannot resolve context componentnotregisteredexception backgroundscope working net framework application using autofac dependency injection hangfire background jobs service class storedatacleanupservice depends ef aspnetentityframeworkautofacbackgroundprocesshangfire assist asked apr
634"focus on the next textfield/securefield in swiftui i've built a login screen in swiftui. i want to focus on the password securefield when the user is finished entering their email. how can i do this? struct loginview: view { @state var username: ... iosswiftui daniel ryan 7,100 asked oct 16, 2019 at 22:25","['ios', 'swiftui']",en,focus next textfieldsecurefield swift built login screen swift want focus password securefield user finished entering email struct loginview view state var username iosswiftui daniel ryan asked oct
635"angular 2 http get not getting i new to angular 2 still learning i am trying to hit a url with a get call but the get doesn't seem to go through even in browser's network i cannot find that get url being called. the program is ... angularangular-http user7161814 asked dec 29, 2016 at 13:59","['angular', 'angular-http']",en,angular http get getting new angular still learning trying hit url get call get seem go even browsers network cannot find get url called program angularangularhttp user asked dec
636"mockgooglecredential in c# i'd like to mock a googlecredential class. i found a lot of results for java. but nothing for c#. is there a special nuget package? or an alternative? c#nsubstitute robert25 31 asked jan 31, 2024 at 18:28","['c#', 'nsubstitute']",en,mockgooglecredential c would like mock googlecredential class found lot results java nothing c special nugget package alternative csubstitute robert asked jan
637"rtk query after invalidation it still uses old cache data after deletion of the cached data i have to make 2 calls getusercontacts getalluserscontacts the second call getalluserscontacts successfully updates the cache data but the first call shows in the ... reactjsreact-reduxrtk-query rob111 1,257 asked jun 28, 2024 at 14:03","['reactjs', 'react-redux', 'rtk-query']",en,rt query validation still uses old cache data deletion cached data make calls getusercontacts getalluserscontacts second call getalluserscontacts successfully updates cache data first call shows reactjsreactreduxrtkquery rob asked jun
638"node 10 - `node-gyp rebuild` error during npm install i've recently upgraded to node 10 and when i run npm install i get the following error: make: *** [release/obj.target/memwatch/src/init.o] error 1 gyp err! build error gyp err! stack error: `make` ... node.jsnode-gyp david faizulaev 5,771 asked jan 17, 2019 at 13:26","['node.js', 'node-gyp']",en,node nodegap rebuild error num install recently upgraded node run num install get following error make releaseobjtargetrematchsrcinito error gap err build error gap err stack error make nodenodegap david faizulaev asked jan
639"locust: how to specify volume of requests in time period? i'm interested in using locust to load test an endpoint. from documentation (see third ""note"" section.) for example, if you want locust to run 500 task iterations per second at peak load, ... pythonlocust jbuddy_13 1,248 asked nov 27, 2023 at 22:41","['python', 'locust']",en,locust specify volume requests time period interested using locust load test endpoint documentation see third note section example want locust run task iterations per second peak load pythonlocust buddy asked nov
640"typeerror: descriptor '__init__' requires a 'super' object but received a 'str' using python 3.x as the interpreter. i just had inherited the employee class with two of the derived class as developer and manager. the below code is throwing a type error: '__init__' requires a '... pythonpython-3.xpython-2.7 subhendu panda 463 asked jan 20, 2018 at 7:29","['python', 'python-3.x', 'python-2.7']",en,typeerror descriptor init requires super object received str using python x interpreter inherited employee class two derived class developer manager code throwing type error init requires pythonpythonpython subhendu panda asked jan
641"update firebase user profile i am trying to update my app, so that users can create profiles with more than just an email and password. but i keep on getting different errors for each method i try. i want to start only with the ... javascriptreact-nativefirebase-authenticationexpo hecker 13 asked jul 1, 2023 at 20:48","['javascript', 'react-native', 'firebase-authentication', 'expo']",en,update fishbase user profile trying update app users create profiles email password keep getting different errors method try want start javascriptreactnativefirebaseauthenticationexpo decker asked jul
642"unexpected generator behaviour when not assigned to a variable could someone explain the difference between these two executions? here is my generator function: def g(n): try: yield n print(""first"") except baseexception as e: ... pythonexceptiongenerator joan ràfols 75 asked jul 5, 2024 at 8:53","['python', 'exception', 'generator']",en,unexpected generator behaviour assigned variable could someone explain difference two executions generator function def gn try yield n printfirst except baseexception e pythonexceptiongenerator joan rafolk asked jul
643"connecting to a docker-compose mysql container denies access but docker running same image does not i am having some issues connecting to the mysql docker container that i have launched with docker-compose. this is a long post (sorry!). here is my docker-compose.yml file: db: image: mysql:5.7 ... mysqldockerdocker-compose davy kavanagh 4,959 asked may 26, 2016 at 11:04","['mysql', 'docker', 'docker-compose']",en,connecting deckercompose container denies access decker running image issues connecting decker container launched deckercompose long post sorry deckercomposeml file db image mysqldockerdockercompose day kavanagh asked may
644"how to repeat textbox on every page of ssrs report i have one tablix on my report and i placed one textbox on the tablix this textbox works as a watermark for the report and it's working fine but i have to repeat this textbox on every page of the ... reporting-servicesssrs-2008 hassan_ali52 3 asked jan 22, 2024 at 21:28","['reporting-services', 'ssrs-2008']",en,repeat taxobox every page ssrn report one table report placed one taxobox table taxobox works watermark report working fine repeat taxobox every page reportingservicesssrs hassanali asked jan
645"maui - create public variable once on start and trigger update i'm new to maui/c# and still struggle to understand the logic/syntax. i have a collectionview bound to an instance ""datelist"" <collectionview itemssource=""{binding datelist}"" &... c#syntaxglobal-variablesmaui canedha 63 asked jun 28, 2023 at 4:37","['c#', 'syntax', 'global-variables', 'maui']",en,mai create public variable start trigger update new maic still struggle understand logicsyntax collectionview bound instance delist collectionview itemssourcebinding delist csyntaxglobalvariablesmaui canada asked jun
646"do i need a vpc created before i pass on the value to the internet gateway in terraform i am learning terraform using modules. i have created two modules for vpc and internet gateway. please find the code below provider ""aws"" { profile = ""default"" region = ""... amazon-web-servicesterraformterraform-provider-awsterraform0.12+ wajid461 11 asked feb 15, 2024 at 22:20","['amazon-web-services', 'terraform', 'terraform-provider-aws', 'terraform0.12+']",en,need pc created pass value internet gateway terraform learning terraform using modules created two modules pc internet gateway please find code provider aws profile default region amazonwebservicesterraformterraformproviderawsterraform said asked feb
647"changing a spline in threejs dynamically i have this code drawing a sinewave which works great, but when i call the function to draw it over again with different values, it doesn't do anything. the code in the function is the exact same as ... javascript docaberle 49 asked aug 26, 2024 at 1:08",['javascript'],en,changing spine three dynamically code drawing sinewave works great call function draw different values anything code function exact javascript docaberle asked aug
648"how to find frame length of stereo mp3 related question in stack overflow here framesize = 144 * bitrate / (samplerate + padding) gives the frame length. so is it the same for stereo data ? i have a mp3 file with bit rate 128kbps, sample ... python-3.xmp3voicedecoder jpambattu 21 asked jan 13, 2024 at 8:49","['python-3.x', 'mp3', 'voice', 'decoder']",en,find frame length stereo mp related question stack overflow framesize nitrate samplerate padding gives frame length stereo data mp file bit rate kbs sample pythonampvoicedecoder jpambattu asked jan
649"x2go client: error in the connection load module (path) i am using x2go in my servers, and it is working perfectly and is very fast. but in some servers that some modules are loaded in login time in this path /etc/profile.d/mymodules.sh there is a problem. ... linuxmoduleloadx2go mostafa elyasi 7 asked jun 19, 2024 at 11:06","['linux', 'module', 'load', 'x2go']",en,xgo client error connection load module path using xgo servers working perfectly fast servers modules loaded login time path etcprofiledmodulessh problem linuxmoduleloadxgo montana elpais asked jun
650"unityengine.ui not working, ive tried a lot of fixes but im still getting this error the type or namespace name 'ui' does not exist in the namespace 'unityengine' (are you missing an assembly reference?) this is the error i'm getting, i've got thousands of errors in my project ... c#visual-studiounity-game-engine olizen 1 asked feb 26, 2024 at 11:33","['c#', 'visual-studio', 'unity-game-engine']",en,unityengineui working tried lot fixes still getting error type namespace name ui exist namespace unityengine missing assembly reference error getting got thousands errors project cvisualstudiounitygameengine alien asked feb
651"preserving initial route when using runapp() multiple in flutter i'm facing an issue when utilizing runapp() twice for initialization in a flutter app. here's a simplified scenario of the problem: void main() async { runapp(const splashapp()); await ... flutterdartflutter-go-router kkimj 17 asked jan 2, 2024 at 1:00","['flutter', 'dart', 'flutter-go-router']",en,preserving initial route using runapp multiple clutter facing issue utilizing runapp twice initialization clutter app simplified scenario problem void main sync runappconst splashapp await flutterdartfluttergorouter kim asked jan
652"hugging face http request on data from parquet format when the only way to get it is from the website's data viewer, how to fix? due to hugging face datasets disappearing, i've had to get the data from their data viewer using the parquet option. but when i try to run it, there is some sort of http error. i've tried downloading ... nlphuggingfacehuggingface-datasetshuggingface-hub charlie parker 5,476 asked aug 17, 2023 at 17:19","['nlp', 'huggingface', 'huggingface-datasets', 'huggingface-hub']",en,tagging face http request data parque format way get websites data viewer fix due tagging face datasets disappearing get data data viewer using parque option try run sort http error tried downloading nlphuggingfacehuggingfacedatasetshuggingfacehub charlie parker asked aug
653"sudden occurrence of idx10500 [closed] over the weekend, we saw one of our services suddenly rejecting tokens issued by microsoft entra id. we have two tenants, lets call them a and b. service 1 (hosted in a) is configured to use bearer ... jwtopenid-connectmicrosoft-entra-id ar es 431 asked 2 days ago","['jwt', 'openid-connect', 'microsoft-entra-id']",en,sudden occurrence idx closed weekend saw one services suddenly rejecting tokens issued microsoft entra id two tenants let us call b service hosted configured use bearer jwtopenidconnectmicrosoftentraid ar es asked days ago
654"std::unordered_map assignment after initialization compile error i am running into a realy weird error when trying to inherit from std::unordered_map. in this code, i just want to specialize std::unordered<> map into a class to have it simple writing code ... c++ ghislain 1 asked jan 1, 2024 at 22:34",['c++'],en,stdorderedmap assignment initialization compile error running really weird error trying inherit stdorderedmap code want specialize stdordered map class simple writing code c ghislain asked jan
655"my code is not dsiplaying my profile screen content to see my profile screen this is my viewmodel @hiltviewmodel class galbaatviewmodel @inject constructor( val auth: firebaseauth, var db : firebasefirestore, val storage : firebasestorage ) : viewmodel() { var ... androidfirebasekotlinandroid-jetpack-composedagger-hilt tejaswi bhagat 1 asked apr 16, 2024 at 8:12","['android', 'firebase', 'kotlin', 'android-jetpack-compose', 'dagger-hilt']",en,code displaying profile screen content see profile screen viewmodel hiltviewmodel class galbaatviewmodel inject constructor val auth firebaseauth var db firebasefirestore val storage firebasestorage viewmodel var androidfirebasekotlinandroidsetbackcomposedaggerhilt tejaswi bharat asked apr
656"ios location - didupdatelocations not called i am trying to get location. issue is that func locationmanager(_ manager: cllocationmanager, didchangeauthorization status: clauthorizationstatus) and locationmanager(_ manager: cllocationmanager, ... iosswiftcore-location rch 1,309 asked dec 18, 2023 at 9:45","['ios', 'swift', 'core-location']",en,ios location didupdatelocations called trying get location issue func locationmanager manager cllocationmanager didchangeauthorization status clauthorizationstatus locationmanager manager cllocationmanager iosswiftcorelocation rch asked dec
657"error when using s3-sync-client and @aws-sdk/client-s3 with webpack in electron project i am working on an electron project and i have configured webpack for it. i recently installed s3-sync-client and @aws-sdk/client-s3 using npm, but when i try to run the project, i get the following ... webpackelectronaws-sdkwebpack-loader heena love trivedi 61 asked mar 22, 2023 at 11:37","['webpack', 'electron', 'aws-sdk', 'webpack-loader']",en,error using ssyncclient awssdkclients webpage electron project working electron project configured webpage recently installed ssyncclient awssdkclients using num try run project get following webpackelectronawssdkwebpackloader helena love tried asked mar
658"which java type do you use for jpa collections and why? which of the following collection types do you use in your jpa domain model and why: java.util.collection java.util.list java.util.set i was wondering whether there are some ground rules for this. ... javajpajpa-2.0 theo 3,135 asked jan 11, 2011 at 7:58","['java', 'jpa', 'jpa-2.0']",en,java type use ja collections following collection types use ja domain model javauntilcollection javauntillist javauntilset wondering whether ground rules javajpajpa theo asked jan
659"how to schedule a task at go periodically? is there any native library or third party support like scheduledexecutorservice by java native library at go lang for production use case? please find the code snippet in java 1.8 : import java.... goscheduled-tasksscheduler siddhanta rath 1,036 asked oct 30, 2018 at 4:04","['go', 'scheduled-tasks', 'scheduler']",en,schedule task go periodically native library third party support like scheduledexecutorservice java native library go lang production use case please find code snippet java import java scheduledtasksscheduler siddhanta math asked oct
660"'some services are not able to be constructed (error while validating the service descriptor 'servicetype: i'm creating an application in .net 7, using dapper in the layers pattern, apresetation, application, domain, infra .net 7 doesn't have startup.cs to do the injections, i'm doing them in program.cs. ... .netdapper sunoct 5 asked oct 15, 2023 at 15:18","['.net', 'dapper']",en,services able constructed error validation service descriptor servicetype creating application net using rapper layers pattern presentation application domain infra net startupcs injections programcs netdapper sunset asked oct
661"jmeter warning: nashorn engine is planned to be removed from a future jdk release when i run jmeter 5.1.1 recently downloaded, i see many times in terminal window: warning: nashorn engine is planned to be removed from a future jdk release i've used web search and found jep 335: ... javascriptjavajmeternashorndeprecation-warning alex martian 3,860 asked oct 16, 2019 at 14:46","['javascript', 'java', 'jmeter', 'nashorn', 'deprecation-warning']",en,meter warning ashore engine planned removed future kidding release run meter recently downloaded see many times terminal window warning ashore engine planned removed future kidding release used web search found jep javascriptjavajmeternashorndeprecationwarning alex martial asked oct
662"plugin with id 'com.google.gms.google-services' not found. [ android ] i was setup firebase firebase official link i'm following this link my 2nd step went through it correctly, but i think i am doing some mistakes in 3rd & the 4th there are some flaws in my code ... javaandroidfirebase user18148338 asked may 11, 2022 at 23:24","['java', 'android', 'firebase']",en,plugin id comgooglegmsgoogleservices found android setup fishbase fishbase official link following link nd step went correctly think mistakes rd th flaws code javaandroidfirebase user asked may
663"how to create a simple association between two tables in phoenix and submit the data i am learning how to configure a belong_to / has_many relationship between two tables. i have the configuration complete but i don't know the syntax to invoke it. i want to take a pre-existing table ... elixirphoenix-frameworkecto william 4,588 asked sep 28, 2023 at 14:09","['elixir', 'phoenix-framework', 'ecto']",en,create simple association two tables phoenix submit data learning configure belongto hasmany relationship two tables configuration complete know syntax invoke want take preexisting table elixirphoenixframeworkecto william asked sep
664"which hook to save woocommerce product meta in woocommerce? i am trying to update a custom meta on woocommerce product update event. i've read that i should use woocommerce_update_product rather than save_post but i cannot figure out why only save_post works ... phpwordpresswoocommerceproducthook-woocommerce mike 107 asked jun 14, 2020 at 17:30","['php', 'wordpress', 'woocommerce', 'product', 'hook-woocommerce']",en,hook save woocommerce product meta woocommerce trying update custom meta woocommerce product update event read use woocommerceupdateproduct rather savepost cannot figure savepost works phpwordpresswoocommerceproducthookwoocommerce mike asked jun
665"exception: the parameters (string,string,null,(class)) don't match the method signature for calendarapp.calendar.createevent i am trying to create a google sheet that i can use to schedule a workshop servicing calendar. i have followed the below tutorial but am getting something wrong, hoping someone can easily identify the ... google-sheetsgoogle-apps-scriptgoogle-calendar-api nic buchanan 3 asked apr 21 at 10:37","['google-sheets', 'google-apps-script', 'google-calendar-api']",en,exception parameters stringstringnullclass match method signature calendarappcalendarcreateevent trying create google sheet use schedule workshop servicing calendar followed tutorial getting something wrong hoping someone easily identify googlesheetsgoogleappsscriptgooglecalendarapi nic buchanan asked apr
666"setting a mariadb session variable in jdbc does not work the following works in dbeaver but not in jdbc: set @@timestamp=unix_timestamp(""2018-01-19 04:14:07.999999""); select current_timestamp result: 2018-01-19 04:14:07.000000 mariadb 10.11.6-... javajdbcmariadb heiko 31 asked jul 29, 2024 at 8:08","['java', 'jdbc', 'mariadb']",en,setting maria session variable jbc work following works beaver jbc set timestampunixtimestamp select currenttimestamp result maria javajdbcmariadb hero asked jul
667"can i conditionally pass a property into an object? is it possible to conditionally pass a property into an object-based function: myfunction .x() .y() .x(); here, i'd like to only pass in y() based on a condition, something like: ... javascriptecmascript-6 daniel aagentah 1,702 asked sep 23, 2022 at 23:10","['javascript', 'ecmascript-6']",en,conditional pass property object possible conditional pass property objectbased function function x x would like pass based condition something like javascriptecmascript daniel magenta asked sep
668"loading data to gold table of dlt pipeline from silver table background: i have created a dlt pipeline with bronze, silver and gold table. bronze and silver are streaming tables and gold is t&l table. the pipeline is running fine with incremental data. ... databricksazure-databricksdelta-lakedelta-live-tables anikesh paul 1 asked oct 30, 2023 at 5:55","['databricks', 'azure-databricks', 'delta-lake', 'delta-live-tables']",en,loading data gold table lt pipeline silver table background created lt pipeline bronze silver gold table bronze silver streaming tables gold tl table pipeline running fine incremental data databricksazuredatabricksdeltalakedeltalivetables anikesh paul asked oct
669"force the title and subtitle to appear on the same slide of a pptx output in quarto r i want to be able to create a powerpoint output in r (using quarto, qmd) but i've been having some difficulties in the actual format of the powerpoint. when i execute the following code: --- title: &... rpowerpointquarto bileobio 150 asked jan 3, 2023 at 17:52","['r', 'powerpoint', 'quarto']",en,force title subtitle appear slide ppt output quarto want able create powerplant output using quarto md difficulties actual format powerplant execute following code title rpowerpointquarto bileobio asked jan
670"export a pandas dataframe as a table image is it possible to export a pandas dataframe as an image file? something like df.to_png() or df.to_table().savefig('table.png'). at the moment i export a dataframe using df.to_csv(). i then open this ... pythonpandas user2370852 590 asked oct 31, 2014 at 15:43","['python', 'pandas']",en,export panda dataframe table image possible export panda dataframe image file something like dftopng dftotablesavefigtablepng moment export dataframe using dftocsv open pythonpandas user asked oct
671"django field validation warnings i am new to django and confronted with the following problem: usually i have a form where i have defined my fields and according validation rules. usually there are fields which have potentially ... djangodjango-formsdjango-validation thomas junk 5,676 asked dec 19, 2023 at 11:44","['django', 'django-forms', 'django-validation']",en,tango field validation warnings new tango confronted following problem usually form defined fields according validation rules usually fields potentially djangodjangoformsdjangovalidation thomas junk asked dec
672"why does `upper_inf` return false when the range uses `infinity` as an explicit upper boundary? postgresql range docs suggest that the magic timestamp infinity should work the same as omitting the bounding value: element types that have the notion of “infinity” can use them as explicit bound ... postgresqlrangeinfinity jan klan 914 asked aug 22, 2024 at 1:27","['postgresql', 'range', 'infinity']",en,upperinf return false range uses infinity explicit upper boundary postgresql range docs suggest magic timestamp infinity work omitting founding value element types notion infinity use explicit bound postgresqlrangeinfinity jan plan asked aug
673"entity framework core does not create join for related entities i've created a couple of entities (code first), a user and a configuration. a user can have multiple configurations and each configuration has a single user. public class configurationdatacontext : ... exceptionentity-framework-coreouter-join bill richards 172 asked oct 15, 2023 at 0:50","['exception', 'entity-framework-core', 'outer-join']",en,entity framework core create join related entities created couple entities code first user configuration user multiple configurations configuration single user public class configurationdatacontext exceptionentityframeworkcoreouterjoin bill richards asked oct
674"delayed display of an updated element i'm adding a spinner to a button when it is clicked in order to indicate to the user that some lengthy processing is occurring. the problem is that the spinner does not get displayed until after the ... htmlbuttondisplay snixdad 49 asked mar 20, 2024 at 12:55","['html', 'button', 'display']",en,delayed display updated element adding spinner button clicked order indicate user lengthy processing occurring problem spinner get displayed htmlbuttondisplay snixdad asked mar
675"using linq to sum up to a number (and skip the rest) if we have a class that contains a number like this: class person { public string name {get; set;} public int amount {get; set;} } and then a collection of people: ilist<person> people; ... c#linq nick 2,907 asked sep 20, 2016 at 11:26","['c#', 'linq']",en,using link sum number skip rest class contains number like class person public string name get set public int amount get set collection people list people clink nick asked sep
676"using the log directive in caddy for both stdout and stderr reading through the caddy docs for log directive, i am unsure how to modify the caddyfile if we want to log both stdout and stderr. i tried starting caddy without errors using the following caddyfile ... caddycaddyfile gameveloster 1,583 asked may 8, 2023 at 2:06","['caddy', 'caddyfile']",en,using log directive candy stout stern reading candy docs log directive unsure modify caddyfile want log stout stern tried starting candy without errors using following caddyfile caddycaddyfile gameveloster asked may
677"how can i merge multiple financial statements into a single dataframe, only by locations? i've been trying to merge mutliple financial statements, without sacrificing line items, and merging all the items along with the years amnd year's value to get the a larger statement with this items ... pythondataframe francisco padron 11 asked may 27, 2024 at 8:21","['python', 'dataframe']",en,merge multiple financial statements single dataframe locations trying merge multiple financial statements without sacrificing line items merging items along years years value get larger statement items pythondataframe francisco patron asked may
678"how do i recover my vs code dev container after setting a dockerfile context and hitting 'unable to resolve resource vscode-remote://...' i have a project that uses vs code dev containers, using docker desktop in windows with wsl2 and roughly has the following structure in ubuntu wsl2. proj |-.devcontainer | |-devcontainer.json | |-... dockerfilevscode-devcontainer andrew weng 21 asked oct 5, 2023 at 3:39","['dockerfile', 'vscode-devcontainer']",en,recover vs code dev container setting dockerfile context hitting unable resolve resource uscoderemote project uses vs code dev containers using decker desktop windows sl roughly following structure ubuntu sl proj devcontainer devcontainerson dockerfilevscodedevcontainer andrew went asked oct
679"customizing the autocomplete widget in flutter i am new to flutter. i need to have several autocomplete fields in a single page, to receive user inputs (either afresh or a selection from the dropdown list attached to each autocomplete field). such ... flutterautocomplete vikarll 111 asked sep 12, 2021 at 10:56","['flutter', 'autocomplete']",en,customizing autocomplete widget clutter new clutter need several autocomplete fields single page receive user inputs either fresh selection dropdown list attached autocomplete field flutterautocomplete vikarll asked sep
680"mongodb difference remove() vs findoneanddelete() vs deleteone() in express and mongodb i want delete document by id findoneanddelete() can not delete by _id, can only delete by field ! why ? db.collection('quotes').findoneanddelete({name: req.body.name}, (err, ... mongodbexpress nguyen don tinh 463 asked mar 10, 2017 at 10:04","['mongodb', 'express']",en,mongodb difference remove vs findoneanddelete vs deletion express mongodb want delete document id findoneanddelete delete id delete field dbcollectionquotesfindoneanddeletename reqbodyname err mongodbexpress nguyen tiny asked mar
681"is there any way to use rollback the db operations performed by set of consecutive api's network calls to help automation is there any way to use rollback the db operations performed by set of consecutive api's network calls to help automation for instance if i have a test script to test my application so my test script ... distributed-transactions ksk 307 asked feb 20, 2023 at 12:01",['distributed-transactions'],en,way use rollback db operations performed set consecutive apis network calls help automation way use rollback db operations performed set consecutive apis network calls help automation instance test script test application test script distributedtransactions ask asked feb
682"can i delete the gch files? i'm currently working on an embedded system, where i've installed and compiled the opencv library. however, i've noticed that the .cpp.gch files are taking up a lot of disk space. can i delete these .... opencvprecompiled-headers ninjabattery 11 asked apr 29, 2024 at 10:16","['opencv', 'precompiled-headers']",en,delete ch files currently working embedded system installed compiled open library however noticed cppch files taking lot disk space delete opencvprecompiledheaders ninjabattery asked apr
683"why swashbuckle not showing request schema link in my .net 6 web api project? i use swashbuckle to generate a swagger page. in response part, i can see schema link: but at the request part, i only see example, but not schema link: this is my c# code [httppost] ... swashbuckleswashbuckle.aspnetcoreswashbuckle.examples daxu 4,152 asked apr 11, 2023 at 15:56","['swashbuckle', 'swashbuckle.aspnetcore', 'swashbuckle.examples']",en,swashbuckle showing request schema link net web api project use swashbuckle generate dagger page response part see schema link request part see example schema link c code httppost swashbuckleswashbuckleaspnetcoreswashbuckleexamples dau asked apr
684"copy all data from the globathy dataset by country to a new folder the globathy is a dataset with bathymetry for almost every lake on the planet (15.58gb .zip available at this link). it contains 1.4m+ records split into a number of sub-directories. there are ... rgisqgis l tyrone 7,593 asked nov 15, 2023 at 2:51","['r', 'gis', 'qgis']",en,copy data globally dataset country new folder globally dataset bathymetry almost every lake planet gb zip available link contains records split number subdirectories rgisqgis l throne asked nov
685"kubectl port forward reliably in a shell script i am using kubectl port-forward in a shell script but i find it is not reliable, or doesn't come up in time: kubectl port-forward ${volt_node} ${volt_cluster_admin_port}:${volt_cluster_admin_port} -n $... kuberneteskubectl eeijlar 1,350 asked may 6, 2021 at 9:43","['kubernetes', 'kubectl']",en,kubectl port forward reliably script using kubectl portforward script find reliable come time kubectl portforward voltnode voltclusteradminportvoltclusteradminport n kuberneteskubectl eeijlar asked may
686"how to use weaviate's admin console locally? is there a local admin console for weaviate? i can see that https://console.weaviate.cloud/ allows you to connect to a local instance, but i would prefer a local one. is there any? weaviate genonymous 1,750 asked oct 5, 2023 at 15:20",['weaviate'],en,use deviates admin console locally local admin console deviate see allows connect local instance would prefer local one deviate anonymous asked oct
687"reactjs timepicker breaking site error occurred in the <forwardref(keyboarddateinput)> component i want to add a timepicker to my formik framework - but when i've tried adding the component. its an older react project mostly using class components - is it because its being rendered in a class ... reactjsmaterial-ui the old county 139 asked jul 31, 2023 at 18:11","['reactjs', 'material-ui']",en,reacts timepicker breaking site error occurred component want add timepicker format framework tried adding component older react project mostly using class components rendered class reactjsmaterialui old county asked jul
688"drag and drop - using jquery to select draggables and droppable -but can't drop since its a reactapp - dndkit i have a reactapp that uses the dndkit library for drag an ddrop. i had a requirement to actually change the behavior of the keyboard drastically. this was for a drag and drop implementation. for some ... jqueryreactjsdraggablednd-kit ali 7,493 asked may 26, 2024 at 17:26","['jquery', 'reactjs', 'draggable', 'dnd-kit']",en,drag drop using query select draggables droppable cannot drop since reactapp dndkit reactapp uses dndkit library drag drop requirement actually change behavior keyboard drastically drag drop implementation jqueryreactjsdraggabledndkit ali asked may
689"i want to install jdk for debian using arm64 but i got todpkg: error: archive 'jdk-20.0.2' is not a regular file, how do i fix? i tried to install java idk using https://www.oracle.com/java/technologies/downloads/#jdk18-linux and wget as well as uncompressing it using tar but when i tried to sudo apt dpkg install on it, it ... javaoracle-databasewgettardpkg tyler roberts 21 asked aug 10, 2023 at 3:34","['java', 'oracle-database', 'wget', 'tar', 'dpkg']",en,want install kidding design using arm got todpkg error archive jk regular file fix tried install java id using get well uncompressing using tar tried judo apt pkg install javaoracledatabasewgettardpkg tyler roberts asked aug
690"deploying mern stack app with multer for file uploads i recently finished an e-commerce mern stack app to ad to my portfolio. now i want to deploy it but have no idea where to start. i use multer middleware for file storage and images are being stored in ... deploymentmulter joshua lazar 1 asked jan 25, 2024 at 17:06","['deployment', 'multer']",en,deploying men stack app muster file uploads recently finished ecommerce men stack app ad portfolio want deploy idea start use muster middleware file storage images stored deploymentmulter joshua lamar asked jan
691"how to reinitialize usb enumeration in stm32 microcontrollers using only software? i am working on a usb msc project that requires different usb sticks to be able to connect to the stm32f429. i am using hal libraries. some usb sticks require restarting or re-enumeration for file ... cembeddedstm32 nima aghayan 159 asked dec 12, 2023 at 13:08","['c', 'embedded', 'stm32']",en,reinitialize usb enumeration stm microcontrollers using software working usb msc project requires different usb sticks able connect stmf using hal libraries usb sticks require restarting reenumeration file cembeddedstm nima aghayan asked dec
692"format text based on text style using react js i need to format text based on provided text specific style using react js. e.g: here i have observed one thing like, if i pass text with some variable e.g: const text = ""\\nbubble\\nair\\nsky&... reactjs vishal 1 asked aug 12, 2024 at 10:39",['reactjs'],en,format text based text style using react js need format text based provided text specific style using react js eg observed one thing like pass text variable eg const text bubbleairsky reacts visual asked aug
693"how to smoothly animate a conic gradient background in css? [duplicate] i’m trying to create a smooth animation effect for a conic gradient background in css. my goal is to have the gradient appear to shift smoothly without rotating the entire element. here’s the css i’m ... javascripthtmlcsscss-animationsgradient mukesh odhano 1 asked jun 25, 2024 at 10:58","['javascript', 'html', 'css', 'css-animations', 'gradient']",en,smoothly animate conic gradient background css duplicate trying create smooth animation effect conic gradient background css goal gradient appear shift smoothly without rotating entire element css javascripthtmlcsscssanimationsgradient makes odhano asked jun
694"sortby function combined with unique and filter functions: how to use it correclty? i have the following table in excel, namely ""table1"": check city country yes new york usa yes barcelona spain no rome italy the field ""check"" is dynamically calculated with a ... excelexcel-formula stefano 179 asked jul 4, 2021 at 16:07","['excel', 'excel-formula']",en,sortby function combined unique filter functions use correctly following table excel namely table check city country yes new york usa yes barcelona spain rome italy field check dynamically calculated excelexcelformula stefan asked jul
695"escaping simple quote in twig i'm using this twig query: {% if xpath('md_file','//archive/dossier_mdph[contains(""#filename#"", identifiant)]') %}{{ xpath('md_file','//archive/dossier_mdph[contains(""#filename#"", ... xpathtwigescaping pick 57 asked mar 7, 2024 at 21:15","['xpath', 'twig', 'escaping']",en,escaping simple quote twig using twig query pathmdfilearchivedossiermphcontainsfilename identifiant pathmdfilearchivedossiermphcontainsfilename xpathtwigescaping pick asked mar
696"why must a lambda expression be cast when supplied as a plain delegate parameter take the method system.windows.forms.control.invoke(delegate method) why does this give a compile time error: string str = ""woop""; invoke(() => this.text = str); // error: cannot convert lambda ... c#c#-3.0delegateslambda xyz 27.9k asked jan 4, 2009 at 20:00","['c#', 'c#-3.0', 'delegates', 'lambda']",en,must lambda expression cast supplied plain delegate parameter take method systemwindowsformscontrolinvokedelegate method give compile time error string str wood invoke thistext str error cannot convert lambda ccdelegateslambda xyz k asked jan
697"authentication in mysql8 with docker [duplicate] i've been reading the threads about connecting to a mysql instance running in a docker container, tried all the magic solutions and none of them seem to work. i have a working php app, and phpadmin ... mysqldocker furball 3 asked sep 21, 2023 at 22:25","['mysql', 'docker']",en,authentication decker duplicate reading threads connecting instance running decker container tried magic solutions none seem work working php app phpadmin mysqldocker fussball asked sep
698"add text with specific height to pdf tcpdf i'm having trouble getting some text to be added to a pdf in te correct measurement with tcpdf. this is the function i'm writing for adding a cell with text. in this particular example i have called ... phplaraveltcpdf christoffer 7,797 asked nov 2, 2023 at 16:33","['php', 'laravel', 'tcpdf']",en,add text specific height pdf pdf trouble getting text added pdf te correct measurement pdf function writing adding cell text particular example called phplaraveltcpdf christopher asked nov
699"with flink-connector-mongodb, it takes too long to get data i'm trying to configure a batch process using apach flink connector mongodb. it takes almost 10 minutes to retrieve one item from mongodb using flink-connector-mongodb. if no conditions are given in ... apache-flinkmongo-connector user2020758 1 asked 2 days ago","['apache-flink', 'mongo-connector']",en,linkconnectormongodb takes long get data trying configure batch process using apache link connector mongodb takes almost minutes retrieve one item mongodb using linkconnectormongodb conditions given apacheflinkmongoconnector user asked days ago
700"textfield sometimes fails to paste otp code from keyboard suggestion i've noticed that the one-time-password from keyboard suggestions sometimes fails to paste into my text field in my swiftui ios app. most of the time it works, but sometimes the first time i click the ... iosswiftuitextfieldpasteone-time-password wristbands 1,387 asked may 1, 2024 at 19:10","['ios', 'swiftui', 'textfield', 'paste', 'one-time-password']",en,textfield sometimes fails paste top code keyboard suggestion noticed onetimepassword keyboard suggestions sometimes fails paste text field swift ios app time works sometimes first time click iosswiftuitextfieldpasteonetimepassword wristbands asked may
701"set every cell in matrix to 0 if that row or column contains a 0 given a nxn matrix with 0s and 1s. set every row that contains a 0 to all 0s and set every column that contains a 0 to all 0s. for example 1 0 1 1 0 0 1 1 1 0 1 1 1 1 1 1 0 1 1 1 1 1 1 1 1 results ... algorithmoptimizationpuzzle jaircazarin-old-account 2,895 asked dec 4, 2008 at 0:39","['algorithm', 'optimization', 'puzzle']",en,set every cell matrix row column contains given non matrix set every row contains set every column contains example results algorithmoptimizationpuzzle jaircazarinoldaccount asked dec
702"cant't acess pages using tomcat in diferent devices i am using tomcat to host my app. on the machine where i am running the app, it works properly when i enter my website at localhost:8080/app. however, when i try to access it from another computer or ... tomcat dilker winter 1 asked jun 14, 2024 at 0:28",['tomcat'],en,cannott access pages using combat different devices using combat host app machine running app works properly enter website localhostapp however try access another computer combat silver winter asked jun
703"can't convert data.frame into numeric in r i'm working with a dataframe called creditcard in r and i wanted to compute correlation of the variable debt from that same dataframe. however, and i don't know why, it gives me an error message ... rdataframenumeric joão vidal 1 asked dec 8, 2023 at 8:59","['r', 'dataframe', 'numeric']",en,cannot convert dataframe numeric working dataframe called creditcard r wanted compute correlation variable debt dataframe however know gives error message rdataframenumeric joao vital asked dec
704"cannot flush updates when react is already rendering i'm trying to show an alert when the api returns an error. for the alert window i'm using sweetalert2. in my render method i'm checking if the error message contains content. if it contains an error ... javascriptreactjssweetalert j. adam 1,641 asked sep 21, 2019 at 13:44","['javascript', 'reactjs', 'sweetalert']",en,cannot flush updates react already rendering trying show alert api returns error alert window using sweetalert render method checking error message contains content contains error javascriptreactjssweetalert j adam asked sep
705"aws datasync create location s3 failing i am trying to set up data sync to migrate data from a s3 source bucket to a s3 destination bucket in a different account by following the video below: https://www.youtube.com/watch?v=boqasfilgtu i ... amazon-web-servicesamazon-s3command-line-interfaceaws-datasync estrobelai 309 asked jun 12, 2024 at 11:17","['amazon-web-services', 'amazon-s3', 'command-line-interface', 'aws-datasync']",en,aws datasync create location failing trying set data sync migrate data source bucket destination bucket different account following video amazonwebservicesamazonscommandlineinterfacesdatasync estrobelai asked jun
706"why my first load js is in red? i am using next.js 13 with app router i want some suggestion, like why this can happen. or what i can try to reduce this. thank you. below file is page.tsx inside [...slug] folder, which handles all dynamic routes. import react from '... reactjsroutesdynamicnext.js13 mohinder singh 162 asked oct 9, 2023 at 11:41","['reactjs', 'routes', 'dynamic', 'next.js13']",en,first load js red using nextjs app router want suggestion like happen try reduce thank file pagetax inside slug folder handles dynamic routes import react reactjsroutesdynamicnextjs hinder singh asked oct
707"trouble changing background of input textbox i'm trying to create a textbox where if you submit the correct answer, the textbox's background turns green, and red for the incorrect answer. however, nothing seems to happen for both options.
... javascripthtmlbackground-colorrgb harrisino 17 asked dec 29, 2023 at 22:48","['javascript', 'html', 'background-color', 'rgb']",en,trouble changing background input taxobox trying create taxobox submit correct answer taxoboxs background turns green red incorrect answer however nothing seems happen options javascripthtmlbackgroundcolorrgb harrison asked dec
708"how to generate file in media_root in django? in my view i have a function that generates a file but does not return anything. i want the file to be generated in a specific folder in media_root and saved in my models but i'm not sure how exactly ... pythondjango tthheemmaannii 359 asked apr 11, 2024 at 22:00","['python', 'django']",en,generate file mediaroot tango view function generates file return anything want file generated specific folder mediaroot saved models sure exactly pythondjango tthheemmaannii asked apr
709"what is the difference between send_data and send_file in ruby on rails? which one is best for streaming and file downloads? please provide examples. ruby-on-railsrubysendfile mr. black 12.1k asked apr 4, 2011 at 8:08","['ruby-on-rails', 'ruby', 'sendfile']",en,difference senddata sendfile ruby rails one best streaming file downloads please provide examples rubyonrailsrubysendfile mr black k asked apr
710"show something on long press flutter i want to click a button and while i am pressing it to show something on the screen. when i leave the button i want to make it disapear or change it back to the first place, like it was before i ... flutterbutton מאי כהן 17 asked jun 5, 2023 at 10:38","['flutter', 'button']",en,show something long press clutter want click button pressing show something screen leave button want make disappear change back first place like flutterbutton mAy khn asked jun
711"tons of issue with protoc i'm trying to make protoc output the generated files to a folder inside the folder where all my .proto files are. first of all, i hope we can agree that this commands are confusing and isn't very ... goprotocol-buffersprotoc rminaj 595 asked may 20, 2023 at 16:24","['go', 'protocol-buffers', 'protoc']",en,tons issue proto trying make proto output generated files folder inside folder proto files first hope agree commands confusing protocolbuffersprotoc minaj asked may
712"automatically remove duplicate recipients before manually send replyall, (run-time error '91': object variable or with block variable not set) i am using a macro to add specific recipients (contact_group) to my replyall email, depends on a condition and it works as it should. but i found that the original mail may already contain some ... vbaemailoutlook peace 678 asked dec 19, 2023 at 12:38","['vba', 'email', 'outlook']",en,automatically remove duplicate recipients manually send replyall runtime error object variable block variable set using macro add specific recipients contactgroup replyall email depends condition works found original mail may already contain vbaemailoutlook peace asked dec
713"typo3 10 and solr extension - search for partial title not working i am new to the solr topic. typo3 10.4.26 solr-ext 11.2.0 solr-spec 8.11.1 i have the following problem: there is a file search by title, here it searches for ""forklift"" as an example. solr ... solrtypo3typo3-10.xsolr8 benjamin 15 asked apr 19, 2022 at 14:47","['solr', 'typo3', 'typo3-10.x', 'solr8']",en,typo sold extension search partial title working new sold topic typo soldext soldspec following problem file search title searches forklift example sold solrtypotyposold benjamin asked apr
714"is there any reason the <use> tag in html renders an svg in different dimension of height and width? i have an svg element and i want to use it in many places so i used use tag .the use tag inside a svg tag renders the svg in smaller dimension of height and width i.e. i asked for 20x20 dimension and ... htmlcsssvg raje 16 asked jan 9, 2024 at 7:24","['html', 'css', 'svg']",en,reason tag html renders svg different dimension height width svg element want use many places used use tag use tag inside svg tag renders svg smaller dimension height width ie asked x dimension htmlcsssvg race asked jan
715"html div border not showing i'm trying to add a border to a div element in html. below is my code.
#container-border {
border-width: 2px;
border-color: red;
}
<div id=""container-border"">
...
</div>
... htmlcss joseph wahba 770 asked feb 27, 2017 at 22:35","['html', 'css']",en,html div border showing trying add border div element html code containerborder borderwidth px bordercolor red htmlcss joseph wha asked feb
716"sql update multiple rows for a different value based on condition i need to update values (column 'value') in the table (stage.log) on predefined time interval based on their names (column 'name'). could someone help me find an easy way to do this? i use clickhouse ... sqlsql-updateclickhousealter ditrauth 111 asked jul 11, 2023 at 22:48","['sql', 'sql-update', 'clickhouse', 'alter']",en,sql update multiple rows different value based condition need update values column value table stagelog predefined time interval based names column name could someone help find easy way use clickhouse sqlsqlupdateclickhousealter ditrauth asked jul
717"list of showables oop-style in haskell? i want to build a list of different things which have one property in common, namely, they could be turned into string. the object-oriented approach is straightforward: define interface showable and ... haskell artem pelenitsyn 2,588 asked nov 7, 2015 at 19:13",['haskell'],en,list showables topstyle haskell want build list different things one property common namely could turned string objectoriented approach straightforward define interface showall haskell arte pelenitsyn asked nov
718"why is adding attributes to an already instantiated object allowed? i am studying python, and although i think i get the whole concept and notion of python, today i stumbled upon a piece of code that i did not fully understand: say i have a class that is supposed to ... pythonattributespython-3.xdeclaration nlightnfotis 9,821 asked sep 24, 2012 at 16:20","['python', 'attributes', 'python-3.x', 'declaration']",en,adding attributes already instantiated object allowed studying python although think get whole concept notion python today stumbled upon piece code fully understand say class supposed pythonattributespythondeclaration nlightnfotis asked sep
719"ui don't update after edit in ""subview"" my data model is a class which contains an array of objects: class innerdataitem : identifiable, observableobject { var id = uuid() @published var innerinfo = """" init(... swiftswiftui per lindgren 23 asked mar 18, 2024 at 20:30","['swift', 'swiftui']",en,ui update edit purview data model class contains array objects class innerdataitem identifiable observableobject var id uuid published var innerinfo init swiftswiftui per lindgren asked mar
720"trasforming pixel art into ascii art i am trying to do something difficult because i'm a bit insane. i am making a text/ascii adventure game in python for my introduction to programing class. i have a few of the systems i will be using ... pythonhex david staffen 3 asked aug 22, 2023 at 6:04","['python', 'hex']",en,transforming pixel art acid art trying something difficult bit insane making textacid adventure game python introduction programming class systems using pythonhex david staffed asked aug
721"get previous month value power bi dax i have a table with the following measures and columns the ""net month"" and ""beginning balance"" columns are measures, i want to get the ""balance"" column which is ... powerbidaxmeasureconsecutive-months cami 33 asked jan 30, 2024 at 17:45","['powerbi', 'dax', 'measure', 'consecutive-months']",en,get previous month value power bi day table following measures columns net month beginning balance columns measures want get balance column powerbidaxmeasureconsecutivemonths came asked jan
722"compress secp256k1 elliptic curve x, y coordinates strings strings into hex public key for context i am using the azurerm_key_vault_key terraform resource to create an secp256k1 key. i can output the x and y coordinates for this key as strings that look like this (appears to be a base64 ... pythonecdsaelliptic-curvepython-cryptography karl 5,822 asked jul 24, 2023 at 19:26","['python', 'ecdsa', 'elliptic-curve', 'python-cryptography']",en,compress seck elliptic curve x coordinates strings strings hex public key context using azurekeyvaultkey terraform resource create seck key output x coordinates key strings look like appears base pythonecdsaellipticcurvepythoncryptography karl asked jul
723"openai gymsupermariobros object has no attribute 'render_mode' i'm trying to using stable-baselines3 ppo model to train a agent to play gym-super-mario-bros,but when it runs, here is the basic model train code: from nes_py.wrappers import joypadspace import ... reinforcement-learningopenai-gymstable-baselines catalyst 11 asked jul 7, 2023 at 20:21","['reinforcement-learning', 'openai-gym', 'stable-baselines']",en,open gymsupermariobros object attribute rendermode trying using stablebaseline ppo model train agent play gymsupermariobrosbut runs basic model train code nespyrappers import joypadspace import reinforcementlearningopenaigymstablebaseline catalyst asked jul
724"why does it seem impossible to develop a stable background service on android? [closed] i've been sporadically developing apps (for android) for years now. i've never managed to implement a background service that doesn't terminate, or at least restarts reliably. am i the only one who ... androidbackground-process dryzler 17 asked apr 21 at 11:23","['android', 'background-process']",en,seem impossible develop stable background service android closed sporadically developing apps android years never managed implement background service terminate least restart reliably one androidbackgroundprocess dryer asked apr
725"error in springboot getting property name instead of the value i'm new in spring-boot and i development a api-rest application. i have a problem with my application.properties when i run my app this get the property name instead of the property value. **i´m usig ... springspring-bootspring-mvc petersonname 1 asked jan 19, 2024 at 0:10","['spring', 'spring-boot', 'spring-mvc']",en,error springboot getting property name instead value new springboot development apirest application problem applicationproperties run app get property name instead property value im using springspringbootspringmvc petersonname asked jan
726"how i can attach a pvc to a pv released? i am trying to deploy a pod in kubernetes using helm which use a persistent volume that it is going to disconnect its pvc each time that i redeploy. when i do that the persistent volume it goes to ... kubernetespersistencepersistent-volumeskubernetes-pvc jesus montilla 1 asked mar 6, 2023 at 8:02","['kubernetes', 'persistence', 'persistent-volumes', 'kubernetes-pvc']",en,attach pmc pv released trying deploy pod kubernetes using helm use persistent volume going disconnect pmc time deploy persistent volume goes kubernetespersistencepersistentvolumeskubernetespmc jesus mozilla asked mar
727"how to maintain scroll position of screen when calling setstate in flutter when calling setstate(), scroll position of screen is changed. it happens in listview or screen with scroll. maintain scroll position in listview maintain scroll position in singlechildscrollview ... flutterdartuser-interface krazy 347 asked feb 21, 2024 at 4:54","['flutter', 'dart', 'user-interface']",en,maintain scroll position screen calling estate clutter calling estate scroll position screen changed happens listview screen scroll maintain scroll position listview maintain scroll position singlechildscrollview flutterdartuserinterface crazy asked feb
728"when using crypto subtle in javascript to sign a message, do we need to sign the hash of the encoded message or the encoded message itself? when using the browser built in crypto subtle in javascript to sign a message, do we need to sign the hash of the encoded message or the encoded message itself? the reason i ask is because as per the ... hashcryptographydigital-signatureecdsawebcrypto-api sudoexclamationexclamation 8,832 asked may 28, 2023 at 4:35","['hash', 'cryptography', 'digital-signature', 'ecdsa', 'webcrypto-api']",en,using crypto subtle javascript sign message need sign hash encoded message encoded message using browser built crypto subtle javascript sign message need sign hash encoded message encoded message reason ask per hashcryptographydigitalsignatureecdsawebcryptoapi sudoexclamationexclamation asked may
729"how to take all integer data from a database column and transform it into float in pandas? i'm taking a data science course and i came across an exercise that left me confused. import pandas as pd pd.set_option('display.max_colwidth', none) jeopardy = pd.read_csv('jeopardy.csv') jeopardy.... pythonpandasdataframetypeerror user23059245 asked dec 11, 2023 at 17:13","['python', 'pandas', 'dataframe', 'typeerror']",en,take integer data database column transform float panda taking data science course came across exercise left confused import panda pd pdsetoptiondisplaymaxcolwidth none jeopardy pdreadcsvjeopardycsv jeopardy pythonpandasdataframetypeerror user asked dec
730"get zoom level without getting recomposition for the whole googlemap i'm using google maps with compose. i've got one problem to solve. i thought it will be quite easy to code but it looks like i'm missing something. my google map in compose is quite common: googlemap( ... kotlinandroid-jetpack-composegoogle-maps-compose adek 3,121 asked apr 12, 2023 at 20:12","['kotlin', 'android-jetpack-compose', 'google-maps-compose']",en,get zoom level without getting decomposition whole googlemap using google maps compose got one problem solve thought quite easy code looks like missing something google map compose quite common googlemap kotlinandroidsetbackcomposegooglemapscompose ade asked apr
731"failure to partition a dataframe to write to deltalake i'm getting an illegalargumentexception while attempting to write to delta. e pyspark.sql.utils.illegalargumentexception: requirement failed: the provided partitioning does not match of ... pythonapache-sparkpysparkdelta-lake geosphere 375 asked nov 21, 2023 at 13:02","['python', 'apache-spark', 'pyspark', 'delta-lake']",en,failure partition dataframe write deltalake getting illegalargumentexception attempting write delta e sparksqluntilillegalargumentexception requirement failed provided partitioning match pythonapachesparkpysparkdeltalake biosphere asked nov
732"custom marker in openstreetmap the icon of marker is an image. so when i zoom in, the icon size does not change and it gets very difficult to click on the marker. i want that i should be able to set up the marker icon so that the ... google-maps-markersopenstreetmaposmdroid agarl 3 asked aug 2, 2023 at 7:32","['google-maps-markers', 'openstreetmap', 'osmdroid']",en,custom marker openstreetmap icon marker image zoom icon size change gets difficult click marker want able set marker icon googlemapsmarkersopenstreetmaposmdroid agar asked aug
733"fail to load a wasm file in a web application i'm trying to host a website, and i use a .wasm file with .js scripts created by the wasm-pack tool. i tested the project locally with npm and node.js and everything worked fine. but then i hosted it ... javascriptapachefetchmime-typeswebassembly rambi 1,279 asked oct 11, 2020 at 19:59","['javascript', 'apache', 'fetch', 'mime-types', 'webassembly']",en,fail load file web application trying host website use file js scripts created waspack tool tested project locally num nodejs everything worked fine hosted javascriptapachefetchmimetypeswebassembly rabbi asked oct
734"exclude nestedfields in mongodb not working how can you exclude nested fields? e.g. { ""user"": { ""_id"": ""65d0fd1aa10f95578e5c3c94"", ""person_id"": ""... springmongodbkotlin sachin 545 asked feb 18, 2024 at 21:20","['spring', 'mongodb', 'kotlin']",en,exclude nestedfields mongodb working exclude nested fields eg user id dfdaafecc personid springmongodbkotlin machine asked feb
735"error: packets out of order. got: 0 expected: 3 i'm using the mysql module for nodejs, however i keep getting the following error after approximately 10 requests to the database. i'm using the following code to connect to the db: var con = mysql.... mysqlnode.jsdatabase awijol 77 asked jan 9, 2022 at 21:59","['mysql', 'node.js', 'database']",en,error packets order got expected using module nodes however keep getting following error approximately requests database using following code connect db var con mysqlnodedatabase awijol asked jan
736"i want to set full screen like mobilityware solitaire game in my application in android java i'm trying below code for full screen but it's not hide status bar and if i try to remove status bar then not get full screen. please give me proper solution for this. please check --> mobilityware ... javaandroid human 1 asked apr 26, 2024 at 10:00","['java', 'android']",en,want set full screen like mobilityware solitaire game application android java trying code full screen hide status bar try remove status bar get full screen please give proper solution please check mobilityware javaandroid human asked apr
737"how to input a matrix and receive value (or array of values) using machine learning in python? i have a bunch of binary 8x15 matrixes and i want to determine which index (row and column) of the matrix breaks the pattern. say i have the following matrix (simplified to 5x5 for ease, because the ... pythonmachine-learningmatrixscikit-learn pedro r. 11 asked nov 1, 2022 at 21:28","['python', 'machine-learning', 'matrix', 'scikit-learn']",en,input matrix receive value array values using machine learning python bunch binary x matrices want determine index row column matrix breaks pattern say following matrix simplified x ease pythonmachinelearningmatrixscikitlearn pedro r asked nov
738"permission denied when spinning up a neo4j container via colima i recently switched from docker desktop to colima and i've been unable to start a neo4j container eversince. when i run docker-compose, i get the following errors in docker logs, causing neo4j to ... dockerdocker-composeneo4jcolima mikaal anwar 1,791 asked jan 18, 2023 at 2:37","['docker', 'docker-compose', 'neo4j', 'colima']",en,permission denied spinning neoj container via column recently switched decker desktop column unable start neoj container eversince run deckercompose get following errors decker logs causing neoj dockerdockercomposeneojcolima mikka near asked jan
739"submodules in python package are not imported i would like to install my own package for development, i have done this several times without issue, but now, although i add my __init__.py in every module, and my package 'successfully' installs ... pythoninstallationpip hcruiz 95 asked apr 24, 2023 at 13:59","['python', 'installation', 'pip']",en,submodules python package imported would like install package development done several times without issue although add initpy every module package successfully installs pythoninstallationpip cruz asked apr
740"imageanalysis.setanalyzer(executors.newsinglethreadexecutor()) { imageproxy -> block never fires i see my camera feed on screen but imageanalysis.setanalyzer(executors.newsinglethreadexecutor()) { imageproxy -> block never fires. val surfacetexture = textureview.surfacetexture?.... androidandroid-jetpack-compose hope 2,336 asked aug 23, 2024 at 8:45","['android', 'android-jetpack-compose']",en,imageanalysissetanalyzerexecutornewsinglethreadexecutor imageproxy block never fires see camera feed screen imageanalysissetanalyzerexecutornewsinglethreadexecutor imageproxy block never fires val surfacetexture textureviewsurfacetexture androidandroidsetbackcompose hope asked aug
741"weird plot of quiver in python i have a matrix with shape (x,y,z) and in each matrix element i store a 3d array with the components of the magnetic field in that point. but when i try to plot the points at y=0 the quiver ... pythonmatplotlib guillermo fuentes morales 13 asked apr 30, 2024 at 17:03","['python', 'matplotlib']",en,weird plot river python matrix shape xyz matrix element store array components magnetic field point try plot points river pythonmatplotlib guillermo fences morales asked apr
742"stage-whisper is not working because of missing files i tried to install this here: https://github.com/stage-whisper/stage-whisper once i put the audio file in it, it is still loading and loading but not transcribing it. so after that i checked the ... pythonmacosffmpeghomebrewopenai-whisper tingtong 1 asked nov 7, 2023 at 18:17","['python', 'macos', 'ffmpeg', 'homebrew', 'openai-whisper']",en,stagewhisper working missing files tried install put audio file still loading loading transcribing checked pythonmacosffmpeghomebrewopenaiwhisper tingtong asked nov
743"how to use the aws crt http client with hoverfly? i would like to implement the awscrthttpclient and intercept the http requests in the unit tests with hoverfly, but hoverfly is not intercepting the requests. the client is initialized like: private ... javamockingjunit5aws-sdk-java-2.0hoverfly flumenque 55 asked aug 22, 2024 at 19:55","['java', 'mocking', 'junit5', 'aws-sdk-java-2.0', 'hoverfly']",en,use aws crt http client overly would like implement awscrthttpclient intercept http requests unit tests overly overly intercepting requests client initialized like private javamockingjunitawssdkjavaoverly flumenque asked aug
744"can i set alertmanager repeat_interval for a specific receiver/alert? we are using prometheus to send alerts. we have a global repeat_interval route of 10 hours as default, but i would like to up this to 200 hours for a specific receiver/type of alert. i have already ... alertprometheus charles 43 asked may 19, 2021 at 10:50","['alert', 'prometheus']",en,set alertmanager repeatinterval specific receiveralert using prometheus send alerts global repeatinterval route hours default would like hours specific receivertype alert already alertprometheus charles asked may
745"how inter_linear interpolation in opencv resize() work? i am figuring out how opencv resize() function calculates linear interpolation when we set fx=2 and fy=1. i have written the following minimum working example, import cv2 import numpy as np ... opencvresizeinterpolation rasoul 3,857 asked aug 29, 2021 at 20:52","['opencv', 'resize', 'interpolation']",en,interlinear interpolation open resize work figuring open resize function calculates linear interpolation set fx fy written following minimum working example import cv import num problem opencvresizeinterpolation soul asked aug
746"i can't close the alert form mui using the crossicon i have a snackbar and inside an alert both from mui. the issue is that i want to close the alert using a function and when clicking on the crossicon, close it. i don't know why it's not working as i'm ... javascriptcssreactjsmaterial-ui mariadev 87 asked may 16, 2023 at 8:30","['javascript', 'css', 'reactjs', 'material-ui']",en,cannot close alert form mui using crossicon snackbar inside alert mui issue want close alert using function clicking crossicon close know working javascriptcssreactjsmaterialui mariage asked may
747"dynamic display mask that hides the customer phone numbers in the customers table [closed] create table customers ( customerid int primary key, firstname varchar(100), lastname varchar(100), address varchar(100), city varchar(100), province varchar(100), ... sql-servert-sql kinzee 19 asked jan 21, 2024 at 9:11","['sql-server', 't-sql']",en,dynamic display mask hides customer phone numbers customers table closed create table customers customers int primary key firstname archer lastname archer address archer city archer province archer sqlserversql knee asked jan
748"i am trying to generate pdf in angular <button class=""print"" (click)=""generatepdf()"">generate pdf</button> generate pdf code generatepdf(): void { const element = document.getelementbyid('mainprint') as ... javascriptangularangularjstypescriptpdf rahul bonde 28 asked feb 13, 2024 at 4:17","['javascript', 'angular', 'angularjs', 'typescript', 'pdf']",en,trying generate pdf angular generate pdf generate pdf code generated void const element documentgetelementbyidmainprint javascriptangularangularjstypescriptpdf rahul bond asked feb
749"(java) how to map one column of a csv file to another column of a different type? so for this problem, my function is supposed to return the top-10 list of avengers with the most appearances (in decreasing order). in the avenger class it is much like a basic person class however ... javalistjava-streammapping john smith 37 asked apr 29, 2022 at 0:03","['java', 'list', 'java-stream', 'mapping']",en,java map one column csv file another column different type problem function supposed return top list avengers appearances decreasing order avengers class much like basic person class however javalistjavastreammapping john smith asked apr
750how to replace _pam_overwrite with memset? some older code for a pam module uses the _pam_overwrite macro and now generates a compiler warning that something is deprecated. the pam change log mentions that this macro shall no longer be used ... cpam ygoe 20.5k asked apr 18 at 21:19,"['c', 'pam']",en,replace pamoverride member older code pam module uses pamoverride macro generates compiler warning something deprecated pam change log mentions macro shall longer used spam k asked apr
751"how can i rerender a component in react if window.location- changes? i have a react component, that should re-render, when window.location.href changes. this component uses react-helmet and i use it to update the title of the application. i know i could do it with a ... reactjsurlreact-helmet chraebsli 410 asked jun 4, 2023 at 11:14","['reactjs', 'url', 'react-helmet']",en,defender component react windowlocation changes react component rerender windowlocationhref changes component uses reacthelmet use update title application know could reactjsurlreacthelmet chraebsli asked jun
752"netsuite results where one field is true and the other is false that it returns a result of issue i have a search that has a number of different criteria. in the reuslt si need to have a formula that shows what actual criteria is the issue (there is too many to use highlighting as a transaction ... formulanetsuite nic 5 asked apr 28, 2023 at 8:55","['formula', 'netsuite']",en,newsite results one field true false returns result issue search number different criteria result si need formula shows actual criteria issue many use highlighting transaction formulanetsuite nic asked apr
753"plug-in to control led strips. scripting.executescript dont work i am a beginner programmer. i'm writing a plug-in to control led strips from a browser, but i got stuck on a seemingly mundane thing. namely, i am practicing data transfer between different browser ... javascriptgoogle-chrome-extensiontuya adam fijałkowski 1 asked feb 18, 2024 at 15:22","['javascript', 'google-chrome-extension', 'tuya']",en,plugin control led strips scriptingexecutescript work beginner programmer writing plugin control led strips browser got stuck seemingly mundane thing namely practicing data transfer different browser javascriptgooglechromeextensiontuya adam fifalkowski asked feb
754"how to replace content in header of word document using python-docx? i am working on a project where i need to dynamically replace certain placeholders in the header of a word document using python. the header content looks like this. i have a json file with the new ... pythonms-wordheaderpython-docx fffffffff 249 asked dec 11, 2023 at 9:18","['python', 'ms-word', 'header', 'python-docx']",en,replace content header word document using pythondoc working project need dynamically replace certain placeholder header word document using python header content looks like son file new pythonwordheaderpythondoc fffffffff asked dec
755"caused by: java.lang.illegalstateexception: ambiguous mapping found. cannot map 'appcontroller' bean method good morning all, i'm dealing with an ambiguous mapping i cannot decode... i'm using spring mvc 4.0.6 and hibernate 4.3.6 i'm getting this error while launching the war in tomcat: error [localhost-... javaspringhibernate marioc 3,248 asked nov 22, 2015 at 11:26","['java', 'spring', 'hibernate']",en,caused javalangillegalstateexception ambiguous mapping found cannot map appcontroller bean method good morning dealing ambiguous mapping cannot decode using spring mvc liberate getting error launching war combat error localhost javaspringhibernate mario asked nov
756"standard methods for documenting a restful api [closed] i'm writing a specification for a restful api for a new internal web service. it's not hugely long and fairly simple, but even so, it's my first time using strict rest (as opposed to cheating for ... restdocumentation samir talwar 14.3k asked may 22, 2009 at 15:00","['rest', 'documentation']",en,standard methods documenting resentful api closed writing specification resentful api new internal web service hugely long fairly simple even first time using strict rest opposed cheating restdocumentation sami altar k asked may
757"tsql how to assign number to the group i wish to find /assign consecutive number for groups in my data. that <group number> column like in the desired output picture. i just need to add 2 new columns. group number is number per ... sqlsql-servert-sql user1982778 129 asked oct 30, 2023 at 6:48","['sql', 'sql-server', 't-sql']",en,sql assign number group wish find assign consecutive number groups data column like desired output picture need add new columns group number number per sqlsqlserversql user asked oct
758"git won't add modified file no idea why this is happening: git status on branch master changes not staged for commit: (use ""git add <file>..."" to update what will be committed) (use ""git checkout -- <file>..."" ... gitgit-add starkers 10.6k asked sep 25, 2014 at 22:36","['git', 'git-add']",en,git add modified file idea happening git status branch master changes staged commit use git add update committed use git checkout digitadd starters k asked sep
759"typecast to timestamp from stringtype in pyspark how can i typecast a string type to timestamp in pyspark the stringtype data is like this 2024-04-02-19.02.20.000000. i need this column data in timestamp. column is of type string, need to convert in ... apache-sparkpyspark j learner 39 asked may 2, 2024 at 14:55","['apache-spark', 'pyspark']",en,telecast timestamp stringtype spark telecast string type timestamp spark stringtype data like need column data timestamp column type string need convert apachesparkpyspark j learner asked may
760"better way to create these on tailwind css i learned to use @apply it's not recommendable but how can i create this class without @apply ? this is in the index.css file @layer components { .desktop-grid { @apply lg:... tailwind-css carlos raúl cárcamo tejada 15 asked may 15, 2024 at 21:56",['tailwind-css'],en,better way create tailwind css learned use apply commendable create class without apply indexcss file layer components desktopgrid apply lg tailwindcss carlos raul caramo nevada asked may
761"cloudflare <> cloudfront without adding alternative domain name connect to cloudflare/or other dns without adding alternative domain name in cloudfront i'm working on project, that uses cloudfront to serve the content, that goes like this created cloudfront added ... amazon-web-servicescross-domainamazon-cloudfrontcloudflare sanjay khanssk 51 asked jan 13, 2024 at 3:52","['amazon-web-services', 'cross-domain', 'amazon-cloudfront', 'cloudflare']",en,cloudflare cloudfront without adding alternative domain name connect cloudflareor dns without adding alternative domain name cloudfront working project uses cloudfront serve content goes like created cloudfront added amazonwebservicescrossdomainamazoncloudfrontcloudflare sanjay khans asked jan
762"vite build gives qsocketnotifier: can only be used with threads started with qthread error i created a react project with vite. when i run vite build command, it gives qsocketnotifier: can only be used with threads started with qthread error. i haven't created any new files in my project. ... reactjsbuildvite aditya singh 678 asked dec 6, 2022 at 11:58","['reactjs', 'build', 'vite']",en,site build gives qsocketnotifier used threads started thread error created react project site run site build command gives qsocketnotifier used threads started thread error created new files project reactjsbuildvite anita singh asked dec
763"validate array of objects i would like to validate an array of objects sent via postman like that: { pit_fee: [ { range: [1,2] fee:25 }, { range: [3,4] fee:30 }, } this is my validation schema using ... node.jstypescriptexpresstypeorm bigbool98 104 asked oct 24, 2023 at 14:43","['node.js', 'typescript', 'express', 'typeorm']",en,validate array objects would like validate array objects sent via postal like pitfee range fee range fee validation schema using nodejstypescriptexpresstypeorm bigbool asked oct
764"adf pyspark notebook check if directory exist on azure storage account i have notebook using pyspark. a section that i am struggling with is to check if a directory in a container exist on azure data lake storage gen2. if the directory exist i can read the underlying ... pysparkazure-blob-storageazure-data-factory lordrofticus 237 asked jul 31, 2023 at 8:55","['pyspark', 'azure-blob-storage', 'azure-data-factory']",en,adf spark notebook check directory exist azure storage account notebook using spark section struggling check directory container exist azure data lake storage gen directory exist read underlying pysparkazureblobstorageazuredatafactory lordrofticus asked jul
765"google cloud is restricting my device services, and changing my location [closed] i opened a google cloud account, but not not receiving regular web messages to my third party apps. nor am i able to receive replies from individuals i previously text messages with via google voice. ... firebasegoogle-chromecloudrelease von johnson 1 asked 2 days ago","['firebase', 'google-chrome', 'cloud', 'release']",en,google cloud restricting device services changing location closed opened google cloud account receiving regular web messages third party apps able receive replies individuals previously text messages via google voice firebasegooglechromecloudrelease von johnson asked days ago
766"how to repass the nginx closed connection (499) to the associate service i tries capture the close connection in the service associate with the ingress-nginx but i cant find a way. when this situation occur the log of nginx shows the correct status code on log: 172.21.0.... amazon-eksnginx-ingress trevezani 1 asked apr 29, 2024 at 19:10","['amazon-eks', 'nginx-ingress']",en,pass engine closed connection associate service tries capture close connection service associate congressengine cannot find way situation occur log engine shows correct status code log amazoneksnginxcongress trevezani asked apr
767"git workflow explanation below is screenshot of git process from intellij, i am unable to understand what down arrow means? why there are different colors? do they refer to different branches? i have understood every circle ... gitintellij-idea ajay kumar 115 asked feb 2, 2024 at 9:06","['git', 'intellij-idea']",en,git workflow explanation screenshot git process intellij unable understand arrow means different colors refer different branches understood every circle gitintellijidea away kumar asked feb
768"python: how to create dynamically a function with given annotations hints and default values i'm trying to find a way in python to define a function ""at run time"" with given annotations hints and default values. i mean, suppose i have 2 dicts: annotations = {'x': str, 'y': tuple[int]... pythonpython-typing loic rosnay 325 asked oct 5, 2022 at 9:23","['python', 'python-typing']",en,python create dynamically function given annotations hints default values trying find way python define function run time given annotations hints default values mean suppose dict annotations x str titleint pythonpythontyping loc rosa asked oct
769"solved: custom taxonomy conflict with woocommerce? i wrote a custom plugin which only sets a custom post type (dl), its taxonomy/category (downloads) and tag-like taxonomy (tagged). it's on an already established site and the plugin has worked just ... wordpresswoocommercecustom-taxonomy user3061421 1 asked may 6, 2023 at 19:29","['wordpress', 'woocommerce', 'custom-taxonomy']",en,solved custom taxonomy conflict woocommerce wrote custom plugin sets custom post type dl taxonomycategory downloads taglike taxonomy tagged already established site plugin worked wordpresswoocommercecustomtaxonomy user asked may
770"how to delete a file that is still being downloading using stream? the problem is when the user clicks the red x button on the form1 top right corner while a file is downloading. in that case i'm getting this exception: the process cannot access the file 'd:\new ... c#winforms daniel lip 11.3k asked jan 6, 2024 at 21:47","['c#', 'winforms']",en,delete file still downloading using stream problem user clicks red x button form top right corner file downloading case getting exception process cannot access file wouldnew cinforms daniel lip k asked jan
771"laravel postman - retrieving the user model only on second time clicking login i have a user model that has 2 models that are always loaded with it via $with. on user creation those two models are not created since the user has to create them after logging in and those being ... laravelpostmanlaravel-sanctumlaravel-breezesanctum sins tyson 1 asked feb 29, 2024 at 10:55","['laravel', 'postman', 'laravel-sanctum', 'laravel-breeze', 'sanctum']",en,travel postal retrieving user model second time clicking login user model models always loaded via user creation two models created since user create logging laravelpostmanlaravelsanctumlaravelbreezesanctum sins tyson asked feb
772"make.com not pulling value from previous module (returning empty) i am pulling a checkout session from stripe, where i have a custom field (dropdown) for language. the watch and http modules retrieve and return the correct value, but i cannot use it anywhere in the ... variablesautomationstripe-paymentsmake.com renato angelo 1 asked 22 hours ago","['variables', 'automation', 'stripe-payments', 'make.com']",en,makecom pulling value previous module returning empty pulling checkout session stripe custom field dropdown language watch http modules retrieve return correct value cannot use anywhere variablesautomationstripepaymentsmakecom senate angelo asked hours ago
773"git diff suppress ""no newline at end of file"" how can i suppress the ""no newline at end of file"" warning in git diff? $ printf ""1"">1 $ printf ""2"">2 $ git diff 1 2 diff --git a/1 b/2 index 56a6051..d8263ee ... gitgit-diff hanshenrik 21.8k asked oct 10, 2023 at 8:03","['git', 'git-diff']",en,git different suppress decline end file suppress decline end file warning git different print print git different different git b index adee digitdifferent hanshenrik k asked oct
774"redistribute column values within groups based on age & relationship criteria problem: i have a dataframe of individuals, specifying household groups, relationships between household members, and individual ages, and household income. currently total household income hy040g:... rdplyr ravinglooper 221 asked jul 16, 2024 at 12:03","['r', 'dplyr']",en,redistributed column values within groups based age relationship criteria problem dataframe individuals specifying household groups relationships household members individual ages household income currently total household income hyg reply ravinglooper asked jul
775"how to export pptx to image (png, jpeg) in python? i have developed a small code in python to generate a pptx file. but i would like also to generate a picture in png or jpeg of the slide. from pptx import presentation from pptx.util import inches ... pythonpython-pptx alex andre 91 asked may 15, 2020 at 9:20","['python', 'python-pptx']",en,export ppt image png jpeg python developed small code python generate ppt file would like also generate picture png jpeg slide ppt import presentation pptuntil import inches pythonpythonppt alex andre asked may
776"problem with integrating microsoft login to blazorwebapp .net 8.0: unable to cast ""iremoteauthenticationservice"" i try to implement microsoft login to my blazor web app project. im getting an exception when i try clicking the logout button. im getting the error: error: system.invalidcastexception: unable to cast ... c#asp.net-coreblazorasp.net-identity pokkeyuri 13 asked dec 6, 2023 at 13:25","['c#', 'asp.net-core', 'blazor', 'asp.net-identity']",en,problem integrating microsoft login blazorwebapp net unable cast iremoteauthenticationservice try implement microsoft login blazon web app project getting exception try clicking logo button getting error error systeminvalidcastexception unable cast caspnetcoreblazoraspnetidentity pokkeyuri asked dec
777"having issues parsing json data to a type array in react nextjs i am having the following issue. i want to make a fetch that gets json data. use a parser to parse that data to an array of a certain type that is given to the parser as an argument. im very new to ... node.jsreactjsreact-hooks andreas damen 69 asked sep 29, 2023 at 7:18","['node.js', 'reactjs', 'react-hooks']",en,issues parsing son data type array react next following issue want make fetch gets son data use parser parse data array certain type given parser argument new nodejsreactjsreacthooks andreas damn asked sep
778"array_map(): argument #2 ($array) must be of type array, int given this error is showing i want that a user have many products. there is some product which belongs to one user. but it showing array_map(): argument #2 ($array) must be of type array, int given error. i think there is some ... phplaravellaravel-8 abdullah al shahed 25 asked may 22, 2021 at 17:37","['php', 'laravel', 'laravel-8']",en,arraymap argument array must type array int given error showing want user many products product belongs one user showing arraymap argument array must type array int given error think phplaravellaravel abdullah al shared asked may
779"typeerror: none is not valid value for the expected return type integer class solution: def maxrepeating(self, sequence: str, word: str) -> int: k = 0 check = word for x in range(len(sequence)//len(word)): if sequence.count(check)... pythonpython-3.x ak231472 3 asked jun 30, 2023 at 15:34","['python', 'python-3.x']",en,typeerror none valid value expected return type integer class solution def maxrepeatingself sequence str word str int k check word x rangelensequencelenword sequencecountcheck pythonpythonx ak asked jun
780"file change detection tool to find lines of code added, removed, or changed in python i am creating a tool that connects to hundreds of devices across multiple locations that each use javascript to format messages to be sent to our service. i can call each device and have it return its ... python ckemp 11 asked feb 26, 2024 at 2:06",['python'],en,file change detection tool find lines code added removed changed python creating tool connects hundreds devices across multiple locations use javascript format messages sent service call device return python keep asked feb
781"why is list.size()>0 slower than list.isempty() in java? why is list.size()>0 slower than list.isempty() in java? on other words why isempty() is preferable over size()>0? when i look at the implementation in arraylist, then it looks like the speed ... javalist ashish agarwal 6,283 asked oct 2, 2009 at 11:26","['java', 'list']",en,listsize slower listempty java listsize slower listempty java words empty preferable size look implementation arraylist looks like speed javalist assist agarwal asked oct
782"google maps is only loading when app is being sent into background i am facing a peculiar issue, i am trying to update outdated dependencies of my app to current versions. in doing so i removed implementation 'com.google.android.gms:play-services:12.0.1' ... androidgoogle-mapslocationmaps zarar mahmud 197 asked feb 9, 2024 at 9:45","['android', 'google-maps', 'location', 'maps']",en,google maps loading app sent background facing peculiar issue trying update outdated dependencies app current versions removed implementation comgoogleandroidgmsplayservices androidgooglemapslocationmaps para ahmed asked feb
783"slack conversation.list api is not listing private channels as well as direct messages where the bot is part of im using the bot token to get the channel list, but im only getting the public channels not private channels and dms where the bot has been added to here is the permission i have channels:readgroups:... node.jsaxiosslackslack-apislack-commands gnana harish 45 asked jan 25, 2024 at 3:15","['node.js', 'axios', 'slack', 'slack-api', 'slack-commands']",en,slack conversationlist api listing private channels well direct messages bot part using bot token get channel list getting public channels private channels dms bot added permission channelsreadgroups nodejsaxiosslackslackapislackcommands ghana parish asked jan
784"addeventlistener not working for element selected by a new class added from javascript i'm trying to make the button work when the ratings are clicked. otherwise i don't won't the button addeventlistener to work i did check if all the elements are correctly looped through using console.... javascriptdomforeachdom-eventsaddeventlistener huz3y 21 asked may 9, 2024 at 19:16","['javascript', 'dom', 'foreach', 'dom-events', 'addeventlistener']",en,addeventlistener working element selected new class added javascript trying make button work ratings clicked otherwise button addeventlistener work check elements correctly looped using console javascriptdomforeachdomeventsaddeventlistener huzy asked may
785"escape text for html how do i escape text for html use in c#? i want to do sample=""<span>blah<span>"" and have <span>blah<span> show up as plain text instead of blah only with the tags part of ... c#htmlescaping user34537 asked jun 17, 2009 at 5:31","['c#', 'html', 'escaping']",en,escape text html escape text html use c want sampleblah blah show plain text instead blah tags part chtmlescaping user asked jun
786"postgresql group by that includes zeros i have a sql query (postgresql) that looks something like this: select my_timestamp::timestamp::date as the_date, count(*) as count from my_table where ... group by the_date order by the_date ... postgresql-9.5 jma 3,799 asked apr 6, 2022 at 8:38",['postgresql-9.5'],en,postgresql group includes zeros sql query postgresql looks something like select mytimestamptimestampdate thedate count count mytable group thedate order thedate postgresql jma asked apr
787"springboot @kafkalistener got messageconversionexception: cannot convert from a to b i am using springboot 2.7.5 got an issue which the @kafkalistener got the messageconversionexception. the whole error logs show below: bean [example.package.api.kafka.hellokafkalistener@30e312a2]; ... javaspring-bootapache-kafkaspring-kafkaavro zichen ma 997 asked mar 7, 2023 at 14:55","['java', 'spring-boot', 'apache-kafka', 'spring-kafka', 'avro']",en,springboot kafkalistener got messageconversionexception cannot convert b using springboot got issue kafkalistener got messageconversionexception whole error logs show bean examplepackageapiakahellokafkalistenerea javaspringbootapachekafkaspringkafkaavro lichen asked mar
788"build an e-commerce database using prisma i'm working on a personal e-commerce project. i encounter some difficulties regarding the understanding of the collections and their relationships. the e-commerce is meant to sell digital products. so ... databasemongodbprisma g4rf4z 67 asked aug 16, 2023 at 20:39","['database', 'mongodb', 'prisma']",en,build ecommerce database using prism working personal ecommerce project encounter difficulties regarding understanding collections relationships ecommerce meant sell digital products databasemongodbprisma grfz asked aug
789"how to embed power bi report in react app ? access token, master user etc i am creating a react web application to display power bi reports to my customers. the flow is the following : my customers connect on my website, go to the login page, get authenticated with ... reactjspowerbipowerbi-embedded tibjnt 11 asked jan 24, 2023 at 19:35","['reactjs', 'powerbi', 'powerbi-embedded']",en,embed power bi report react app access token master user etc creating react web application display power bi reports customers flow following customers connect website go login page get authenticated reactjspowerbipowerbiembedded tibet asked jan
790"sqlcipher ""file is not a database"" error after updating ios app i'm encountering an issue with sqlcipher in my ios app after updating to a new version, which involves different workspaces of my app. the app uses sqlcipher(version: 3.1) to manage an encrypted ... iosobjective-csqlcipher bathi 381 asked jul 5, 2024 at 15:13","['ios', 'objective-c', 'sqlcipher']",en,sqlcipher file database error updating ios app encountering issue sqlcipher ios app updating new version involves different workspace app app uses sqlcipherversion manage encrypted iosobjectivecsqlcipher bath asked jul
791"netflix dgs codegen + relay pagination unable to generate datafetchers classes i am trying to implement codegen for a maven project (https://github.com/deweyjose/graphqlcodegen) along with relay pagination (https://netflix.github.io/dgs/advanced/relay-pagination/) my schema.... netflix-dgs shamsuddin 11 asked apr 25, 2023 at 12:44",['netflix-dgs'],en,netflix des codgeo relay imagination unable generate datafetchers classes trying implement codgeo project along relay imagination schema netflixdes shamsuddin asked apr
792"how to create a chat menu button in telegrafjs im creating a telegram bot using nodejs and telegrafjs i want to know how to create this menu button i cant find anywhere in documents. it opens up a menu like this one node.jstelegram-bottelegraf.js milad a 145 asked jun 21, 2022 at 16:54","['node.js', 'telegram-bot', 'telegraf.js']",en,create chat menu button telegrafjs creating telegram bot using nodes telegrafjs want know create menu button cannot find anywhere documents opens menu like one nodetelegrambottelegrafjs mild asked jun
793"gremlin query to n hops and traversal of all sub edges and nodes i am trying to create a graph where i can find all relationships with given person and list of their friends. the problem statement my graph looks like this bob ->friends -> jay jay -> ... gremlintinkerpopjanusgraphgremlin-servergremlinpython aaron 686 asked aug 29, 2023 at 19:17","['gremlin', 'tinkerpop', 'janusgraph', 'gremlin-server', 'gremlinpython']",en,kremlin query n hops reversal sub edges nodes trying create graph find relationships given person list friends problem statement graph looks like bob friends jay jay gremlintinkerpopjanusgraphgremlinservergremlinpython aaron asked aug
794"how do i get access to toolbar or inputaccessoryview that appears on top of keyboard without using textfield instance whenever keyboard appears in the project , i can find that by adding observer to uikeyboardwillshownotification. but i want to get access to the tool bar that appears on top of the keyboard globally ... iosuitoolbaruikeyboardiqkeyboardmanagertoolbaritems shajo 203 asked sep 28, 2023 at 19:52","['ios', 'uitoolbar', 'uikeyboard', 'iqkeyboardmanager', 'toolbaritems']",en,get access toolbar inputaccessoryview appears top keyboard without using textfield instance whenever keyboard appears project find adding observer uikeyboardwillshownotification want get access tool bar appears top keyboard globally iosuitoolbaruikeyboardiqkeyboardmanagertoolbaritems sha asked sep
795"azure ios build gets stuck at generating '<appname>.app.dsym' step i am trying to set up a pipeline for an ios application using fastlane and match and i have followed the following guide. azure ios pipeline guide is there anything that i am missing? i have checked ... iosazureazure-devopspipelinefastlane namratha shettigar 1 asked nov 30, 2023 at 13:31","['ios', 'azure', 'azure-devops', 'pipeline', 'fastlane']",en,azure ios build gets stuck generating appsym step trying set pipeline ios application using fastlane match followed following guide azure ios pipeline guide anything missing checked iosazureazuredevopspipelinefastlane namratha shettigar asked nov
796"selenium c#, opening small edge browser and unable to maximize the browser window we're expanding our automation regression testing to include the edge browser as well. presently, we've been employing selenium 4.19, drivermanager 2.17.2, and .net 4.7.2. however, when attempting to ... selenium-webdrivermicrosoft-edgemaximize-window raghu p 65 asked jun 13, 2024 at 18:39","['selenium-webdriver', 'microsoft-edge', 'maximize-window']",en,selenium c opening small edge browser unable maximize browser window expanding automation regression testing include edge browser well presently employing selenium drivermanager net however attempting seleniumwebdrivermicrosoftedgemaximizewindow right p asked jun
797"using 'authorize-security-group-ingress --ip-permissions' for multiple rules while also setting tags i'm scripting some security group handling for our aws ec2 instances. given a freshly-created security group, we can add rules to it like this. (yes, all the port and address numbers are gibberish ... amazon-web-servicesamazon-ec2aws-cli ti strga 1,400 asked may 15, 2023 at 18:39","['amazon-web-services', 'amazon-ec2', 'aws-cli']",en,using authorizesecuritygroupcongress ippermissions multiple rules also setting tags scripting security group handling aws ec instances given freshlycreated security group add rules like yes port address numbers gibberish amazonwebservicesamazonecawscli ti stra asked may
798"upgrade to spring boot 3 with jakarta ee throws a runtime exception unable to build hibernate sessionfactory i am trying to upgrade my project from spring boot 2.7.2 to 3. the project depends on a library that contains the entity classes. following is the pom.xml for the library, where i have moved from ... spring-bootspring-data-jpa rouissi mohamed ali 61 asked feb 25, 2023 at 15:09","['spring-boot', 'spring-data-jpa']",en,upgrade spring boot jakarta ee throws runtime exception unable build liberate sessionfactory trying upgrade project spring boot project depends library contains entity classes following pomxml library moved springbootspringdataja rossi mohamed ali asked feb
799"shopify: how to access a shopify metafield using javascript in a .liquid file? i am trying to access a shopify metafield using javascript in a .liquid file. the metafield is a single line text field. {% javascript %} console.log({{product.metafields.custom.sample_name.value}})... javascriptshopifyliquidmetaobject mikezn 23 asked jun 25, 2023 at 11:22","['javascript', 'shopify', 'liquid', 'metaobject']",en,spotify access spotify metafield using javascript liquid file trying access spotify metafield using javascript liquid file metafield single line text field javascript consolelogproductmetafieldscustomsamplenamevalue javascriptshopifyliquidmetaobject mike asked jun
800"null-aware operator with maps i had the same problem with lists, now it is map. what i would like to do the following syntax is not dart, as in it does not compile: map?[key] ?? othervalue if my map was not a map but a list, it ... dart creativecreatorormaybenot 127k asked jul 2, 2018 at 17:31",['dart'],en,nullaware operator maps problem lists map would like following syntax dart compile mapkey othervalue map map list dart creativecreatorormaybenot k asked jul
801"is there a best practise to for tcp data aggregation in vert.x tcpserver? i am new to vert.x, with a goal of building an iot-platform service. the vert.x ecosystem seems very complete, but i have not found the official advanced usage document about tcpserver data eventbus. ... vert.xvertx-verticlevertx-eventbus peng 1,368 asked apr 24, 2024 at 5:55","['vert.x', 'vertx-verticle', 'vertx-eventbus']",en,best practise tcp data aggregation vertx mapserver new vertx goal building iotplatform service vertx ecosystem seems complete found official advanced usage document mapserver data events vertvertexverticlevertxevents peng asked apr
802"chinese characters appear garbled when adobe illustrator opens a pdf created using reportlab i used reportlab to create a pdf file that contains a chinese text. i have registered the chinese font file. there is no problem when the pdf is opened directly through the browser, and the chinese ... reportlabadobe-illustrator kong xie 1 asked jan 15, 2024 at 14:25","['reportlab', 'adobe-illustrator']",en,chinese characters appear gabled adobe illustrator opens pdf created using reportlab used reportlab create pdf file contains chinese text registered chinese font file problem pdf opened directly browser chinese reportlabadobeillustrator kong die asked jan
803"no context hint and false ""unresolved reference"" on discord.interaction.response.send_message in pycharm i'm using pycharm to write a discord bot with discord.py. every time i use send_message method from the interactionresponse class, i get this ide warning: cannot find reference ""send_message""... pythonpycharmdiscord.pyide meloman 61 asked jun 28, 2023 at 23:06","['python', 'pycharm', 'discord.py', 'ide']",en,context hint false unresolved reference discordinteractionresponsesendmessage charm using charm write discord bot discordpy every time use sendmessage method interactionresponse class get ide warning cannot find reference sendmessage pythonpycharmdiscordpride melon asked jun
804"google documentai not output in the right order of blocks i'm trying to ocr this image using google's documentai. but it seems to output the text in completely wrong orders. here's the image: the output is as follows: piece of clothing, = do up zip up ... google-cloud-platformocrcloud-document-ai jonah_w 1,032 asked may 24, 2023 at 4:23","['google-cloud-platform', 'ocr', 'cloud-document-ai']",en,google documenti output right order blocks trying ocr image using googles documenti seems output text completely wrong orders image output follows piece clothing zip googlecloudplatformocrclouddocumentai jonasw asked may
805"what is state-of-the-art for text rendering in opengl as of version 4.1? [closed] there are already a number of questions about text rendering in opengl, such as: how to do opengl live text-rendering for a gui? but mostly what is discussed is rendering textured quads using the ... opengltextglslshaderopengl-4 ben voigt 284k asked mar 10, 2011 at 16:48","['opengl', 'text', 'glsl', 'shader', 'opengl-4']",en,stateoftheart text rendering open version closed already number questions text rendering open open live textrendering gui mostly discussed rendering textured squads using opengltextglslshaderopengl ben point k asked mar
806"dcap and epid attestation there are two different attestation mechanism which can be used for remote and local attestation in intel sgx . does any one know what are the differences between dcap and epid attestation in intel ... sgx sama 341 asked sep 6, 2022 at 10:47",['sgx'],en,cap pid attenuation two different attenuation mechanism used remote local attenuation intel six one know differences cap pid attenuation intel six sama asked sep
807"ssis build artifact generated from azure devops classic pipeline not reflecting latest changes build pipeline : classic ssis compiler : visual studio\2022\enterprise - devenv.exe (custom) ssis build task version : 2* when running a classic build pipeline in azure devops, can see latest commitid ... azure-devopsssisvisual-studio-2022 timblistic 581 asked nov 28, 2023 at 11:08","['azure-devops', 'ssis', 'visual-studio-2022']",en,isis build artifact generated azure drops classic pipeline reflecting latest changes build pipeline classic isis compiler visual studioenterprise evenexe custom isis build task version running classic build pipeline azure drops see latest committed azuredevopsssisvisualstudio simplistic asked nov
808"pandas/python read file with different separators i have a .txt file as follows: columna;columnb;columnc;columnd 2022040200000000000000000000011 8000702 79005889 special_agency you can observe that the names of the columns are separated by a ... pythonpandasdataframetext-files robsanna 433 asked jan 20, 2023 at 16:42","['python', 'pandas', 'dataframe', 'text-files']",en,pandapython read file different separator txt file follows columncolumncolumncolumn specialagency observe names columns separated pythonpandasdataframetextfiles robsanna asked jan
809"how to check the parallel degree of tables and indexes in oceanbase? in oceanbase (mysql mode), i know that i can set the parallel degree of a table or index using sql commands like: alter table my_table parallel 4; alter index my_index parallel 2; however, for ... parallel-processingoceanbase mars love moon 25 asked apr 21 at 6:56","['parallel-processing', 'oceanbase']",en,check parallel degree tables indexes oceanbase oceanbase mode know set parallel degree table index using sql commands like alter table mytable parallel alter index myindex parallel however parallelprocessingoceanbase mars love moon asked apr
810"what is the --release flag in the java 9 compiler? java 9's javac has a new flag --release: > javac --help ... --release <release> compile for a specific vm version. supported targets: 6, 7, 8, 9 how is it different from -source and -... javajavacjava-9 zhekakozlov 39.8k asked mar 29, 2017 at 19:45","['java', 'javac', 'java-9']",en,release flag java compiler java java new flag release java help release compile specific vm version supported targets different source javajavacjava zhekakozlov k asked mar
811"i can't install npm install --save react-tilt c:\users\johnsam\desktop\react\smartapp>npm install --save react-tilt npm err! code eresolve npm err! eresolve unable to resolve dependency tree npm err! npm err! while resolving: [email protected] ... reactjsnpmnpm-install seng kue vang 23 asked nov 30, 2021 at 8:37","['reactjs', 'npm', 'npm-install']",en,cannot install num install save reacttilt cusersjohnsondesktopreactsmartappnum install save reacttilt num err code resolve num err resolve unable resolve dependency tree num err num err resolving email protected reactjsnpmnpminstall song due lang asked nov
812"combine unnormalized key/value columns into normalized form i'm working on a legacy database with a table that looks like this: account key1 key2 key3 val1 val2 val3 1 home work 555-555-1111 555-555-2222 2 home 555-555-3333 3 mobile work home 555-555-4444 555-... pythonpandasdataframe dacromir 260 asked sep 19, 2022 at 16:58","['python', 'pandas', 'dataframe']",en,combine normalized keyvalue columns normalized form working legacy database table looks like account key key key val val val home work home mobile work home pythonpandasdataframe dacromir asked sep
813"optimizing circle coverage for two-dimensional data points i have a question. i want to solve the problem with the following conditions. the given data are two-dimensional x, y coordinate data. i'd like to include all this data as a circle (two circles can ... pythonmathset-cover yonghyeon 1 asked jan 9, 2024 at 5:41","['python', 'math', 'set-cover']",en,optimizing circle coverage twodimensional data points question want solve problem following conditions given data twodimensional x coordinate data would like include data circle two circles pythonmathsetcover yonghyeon asked jan
814"why am i getting different hash for duplicated files? i need to check for duplicated and corrupted files in a folder with literally millions of files. first, i was trying this way: hash_files = pd.dataframe({""path"":[], ... pythonhashmd5hashlib user026 702 asked jan 22, 2024 at 12:37","['python', 'hash', 'md5', 'hashlib']",en,getting different hash duplicated files need check duplicated corrupted files folder literally millions files first trying way hashfiles pddataframepath pythonhashmdhashlib user asked jan
815"vb.net convert formatted string to double i got a string by formatting a double value, like dim strformat = ""#,##0.00 weeks"" dim strdisplaytext as string = dblin.tostring(strformat) ' dblin is type double then the strdisplaytext is ... vb.netconverters awi2b 57 asked feb 7, 2024 at 14:09","['vb.net', 'converters']",en,vbnet convert formatted string double got string formatting double value like dim strformat weeks dim strdisplaytext string dublinstringstrformat dublin type double strdisplaytext vbnetconverters awib asked feb
816"how to detect if i am in browser (local development) in ionic 2 i want to make sure to launch inappbrowser only if i am on devices (ios, android...), but if i am in browser (local development mode or just a web app with gulp build), i want to just link to that ... cordovaionic-frameworkionic2 hugh hou 2,394 asked jul 19, 2016 at 23:55","['cordova', 'ionic-framework', 'ionic2']",en,detect browser local development ionic want make sure launch inappbrowser devices ios android browser local development mode web app gulf build want link cordovaionicframeworkionic hugh hou asked jul
817"how to scan db result into struct by field name how to scan db results into struct by name? type user struct { id int client_id int email string } rows, _ := tx.query(ctx, ""select id, client_id, email from main.... go clarkk 1 asked aug 28, 2023 at 14:38",['go'],en,scan db result struct field name scan db results struct name type user struct id int clientid int email string rows txqueryctx select id clientid email main go clark asked aug
818"ci pipeline returns an error when running npm ci i have recently tried to add a .yml file for my react project, but the pipeline keeps on hitting an error when the build tries to run npm ci. this runs completely fine on my local machine but doesn't ... reactjsnpmgithub-actions aheed 68 asked oct 4, 2023 at 21:50","['reactjs', 'npm', 'github-actions']",en,ci pipeline returns error running num ci recently tried add ml file react project pipeline keeps hitting error build tries run num ci runs completely fine local machine reactjsnpmgithubactions ahead asked oct
819"azure function : returning an http response data in c# i am using a httpclientfactory to perform a rest api call in my azure function: try { var request = await getsubmissions.getfromjsonasync<helloworld>(""api/blah""); return ... c#.netazure-functions jason_hough 494 asked jul 13, 2023 at 14:30","['c#', '.net', 'azure-functions']",en,azure function returning http response data c using httpclientfactory perform rest api call azure function try var request await getsubmissionsgetfromjsonasyncapiblah return cnetazurefunctions jasonthough asked jul
820"prompt_toolkit not responding to ctrl+d in python try/except block i'm currently working on a python 3.11.5 script on linux mint 21.2 that utilizes the prompt_toolkit library to create a simple command-line interface for updating information about a person. however, ... prompt-toolkitpython-prompt-toolkit silverback 96 asked dec 19, 2023 at 15:14","['prompt-toolkit', 'python-prompt-toolkit']",en,prompttoolkit responding ctrld python tryexcept block currently working python script linux mint utilizes prompttoolkit library create simple commandline interface updating information person however prompttoolkitpythonprompttoolkit silverback asked dec
821"xcode unable to install ""runner"" : please check your project settings and ensure that a valid product has been built i am trying to run an old project from xcode again but it is not installing even though i it build successfully. i didn't change a single line of code. i am using flutter in this project but it not ... iosflutterxcodedartxcode14 swiftiswift 8,827 asked jul 13, 2023 at 15:40","['ios', 'flutter', 'xcode', 'dart', 'xcode14']",en,code unable install runner please check project settings ensure valid product built trying run old project code installing even though build successfully change single line code using clutter project iosflutterxcodedartxcode swiftiswift asked jul
822"use data type uuid or varchar(36) for my uuid column? i'm using postgresql in my project. the primary key column in my table is a character type with length of 36. i generate guids in the backend and store them in the table. do i need to change the ... postgresqldatabase-designuuid alex wright 627 asked mar 30, 2024 at 7:20","['postgresql', 'database-design', 'uuid']",en,use data type uuid archer uuid column using postgresql project primary key column table character type length generate guide backend store table need change postgresqldatabasedesignuuid alex wright asked mar
823"difference between two nsdate objects -- result also a nsdate i have two nsdate objects and i want the difference between the two and the result should again be a nsdate object. any idea how to achieve this? here, i am trying to address a unique problem where i ... iphoneobjective-ccocoa-touchiosnsdate abhinav 38.2k asked apr 6, 2011 at 7:04","['iphone', 'objective-c', 'cocoa-touch', 'ios', 'nsdate']",en,difference two date objects result also date two date objects want difference two result date object idea achieve trying address unique problem iphoneobjectivecocoatouchiosnsdate abhinav k asked apr
824"how to get subscript into formulas text string in excel i need to get this to be a subscript in the output. basically i want all the numbers in the output to be subscripted i have tried this code, and it is part of a large if ""loop"" b2=... excelexcel-formula user53617 23 asked apr 1, 2023 at 21:07","['excel', 'excel-formula']",en,get subscribe formulas text string excel need get subscribe output basically want numbers output subscribed tried code part large loop b excelexcelformula user asked apr
825"excel api's raw_savecopyas() method not working as expected i want to save an .xlsx file and its copy after modifying content in sharepoint location using c++ code. for the first time, i manually saved the file but for the sake of saving its copy, i used excel ... excelfile-copying tony 1 asked apr 27, 2024 at 10:39","['excel', 'file-copying']",en,excel apis rawsavecopyas method working expected want save xls file copy modifying content hardpoint location using c code first time manually saved file sake saving copy used excel excelfilecopying tony asked apr
826"text output from results of apdl i need to write uy1 displacement of node1 as text file in ansys apdl code given in ansys verification manual, vm17. presently, it only gives graph plot of uy1 and i am unable to locate the text file (... workbenchansysansys-apdl muhammad bilal 1 asked oct 7, 2023 at 16:55","['workbench', 'ansys', 'ansys-apdl']",en,text output results pdl need write uy displacement node text file pdl code given verification manual vm presently gives graph plot uy unable locate text file workbenchansysansyspdl muhammad bill asked oct
827"how can i have field based on another field in zod and the good type in output? i have this: const independantschema = baseprofessionalinformationschema.extend({ professional_status: z.literal('independant' satisfies professionalstatus), profession: z.enum( object.... typescriptzod jeromearsene 177 asked apr 21 at 8:10","['typescript', 'zod']",en,field based another field god good type output const independantschema baseprofessionalinformationschemaextend professionalstatus zliteralindependant satisfies professionalstatus profession znum object typescriptzod jeromearsene asked apr
828"the behaviors of executing ./a and ./a < ./fifo1 are different when code need no input file a.cpp is like this: #include <iostream> int main(){ std::cout <<"" hello "" << std::endl; return 0; } i complier it and run ./a, it work normal , output ""... c++fifo 姜梓恒 1 asked apr 20 at 15:04","['c++', 'fifo']",en,behaviors executing int main stdout hello stdend return complies run work normal output cfifa Jiang Zi Heng asked apr
829"change bootstrap-table icon as a start, i would like to change one of the fontawesome icon on the button in the bootstrap-table. for example, i would like to change the columns toggle icon as shown below i have read the ... bootstrap-table brandon j 25 asked jul 10, 2023 at 10:51",['bootstrap-table'],en,change bootstraptable icon start would like change one fontawesome icon button bootstraptable example would like change columns toggle icon shown read bootstraptable brandon j asked jul
830"typeorm and sql server rowversion what typeorm decorators should you use with the sql server rowversion data type? this column decorator correctly creates the column in the database: @column({type: ""rowversion"", nullable: ... sql-servertypeorm jmc42 424 asked feb 7, 2024 at 14:18","['sql-server', 'typeorm']",en,typeorm sql server conversion typeorm decorator use sql server conversion data type column decorator correctly creates column database columntype conversion syllable sqlservertypeorm pmc asked feb
831"in nestjs, how do i build a guard that verifies if the user's email is confirmed? i'm using nestjs 10. i would like to create a guard that protects an endpoint, not only if the user is logged in, but also if they have confirmed their email. i'm using nestjs/passport, and create ... jwtnestjspassport.jsguard dave 19.5k asked nov 13, 2023 at 18:42","['jwt', 'nestjs', 'passport.js', 'guard']",en,nests build guard verifies users email confirmed using nests would like create guard protects endpoint user logged also confirmed email using nestspassport create jwtnestjspassportguard dave k asked nov
832"expected hexadecimal code in braces after unicode escape this worked in the first beta of swift. var degree = ""\u00b0"" // degree symbol now i'm getting this error and i don't understand what i need to do to correct it in xcode 6 beta 5. expected ... swiftxcode6 berry blue 16.6k asked aug 10, 2014 at 2:50","['swift', 'xcode6']",en,expected hexadecimal code braces unicode escape worked first beta swift var degree ub degree symbol getting error understand need correct code beta expected swiftxcode berry blue k asked aug
833"django - get a list of the items for which values exist i have a project in django. i have 2 modules, qlikapp and qlikappuseraccess that are related to a foreignkey. i want to get all the apps that have related 'qlik appuser access' data. how can i do that?... djangodjango-modelsdjango-views itamar 107 asked feb 26, 2024 at 9:36","['django', 'django-models', 'django-views']",en,tango get list items values exist project tango modules qlikapp qlikappuseraccess related foreigner want get apps related qik accuser access data djangodjangomodelsdjangoviews lamar asked feb
834update dataframe cell based on row criteria let's say i have the following dataframe: +----+------------------------------------------------+-------------+----------+----------+ | | string | substring ... pythonpandasdataframe kubiej21 718 asked 2 days ago,"['python', 'pandas', 'dataframe']",en,update dataframe cell based row criteria let us say following dataframe string substring pythonpandasdataframe kurier asked days ago
835"error importing pyarrow in jupyter notebook after pip installation of pyarrow i am having an issue importing pyarrow into my jupyter notebook. to give some context, i created a virtual environment named rc_env. i've uninstalled and reinstalled pyarrow quite a few times but this ... pythonpipjupyter-notebookpyarrow adrian denner 41 asked jul 1, 2021 at 20:28","['python', 'pip', 'jupyter-notebook', 'pyarrow']",en,error importing narrow jupiter notebook pip installation narrow issue importing narrow jupiter notebook give context created virtual environment named rcenv installed installed narrow quite times pythonpipjupyternotebookpyarrow adrian dinner asked jul
836"action after object initializer i want to perform some actions during object creation, but after all properties are initialized. i can't use constructor because it executes before object initializer. var product = new product { ... c#.net doctormatt 13 asked oct 1, 2023 at 22:02","['c#', '.net']",en,action object initializer want perform actions object creation properties initialized cannot use constructor executes object initializer var product new product cnet doctorate asked oct
837"spring resttemplate is not finding recovery method i have this org.springframework.web.client.resttemplate code used in old spring boot microservices configured to work with eureka client/server. i'm trying to make it work with org.springframework.... spring-bootspring-cloudresttemplatefabric8-kubernetes-client peter penzov 1,620 asked apr 18 at 23:03","['spring-boot', 'spring-cloud', 'resttemplate', 'fabric8-kubernetes-client']",en,spring resttemplate finding recovery method orgspringframeworkwebclientresttemplate code used old spring boot microservices configured work europa clientserver trying make work orgspringframework springbootspringcloudresttemplatefabrickubernetesclient peter penzov asked apr
838"lnk1104 when referencing a dynamic library i have a c++ dll project (call it mydll) and a c++ console application in visual studio. i am trying to use this library in my console application but i'm getting a cannot open 'mydll.lib'. here is ... c++dlldynamic-linking user24011790 1 asked aug 21, 2024 at 14:01","['c++', 'dll', 'dynamic-linking']",en,lnk referencing dynamic library c project call model c console application visual studio trying use library console application getting cannot open modellib cdlldynamiclinking user asked aug
839"trigger an event in ubuntu 22.04.2 when a notification is displayed i have this code that comes from a combination of useful articles, google, chat gpt etc. the script is supposed to do something when a notification is displayed. once the script actually works i want ... pythonubuntunotificationsdbus blm99 87 asked aug 2, 2023 at 16:53","['python', 'ubuntu', 'notifications', 'dbus']",en,trigger event ubuntu notification displayed code comes combination useful articles google chat gt etc script supposed something notification displayed script actually works want pythonubuntunotificationsdbus blm asked aug
840"make a bucket public in amazon s3 how can i set a bucket in amazon s3 so all the files are publicly read-only by default? amazon-web-servicesamazon-s3 victor 24k asked mar 30, 2010 at 16:57","['amazon-web-services', 'amazon-s3']",en,make bucket public amazon set bucket amazon files publicly readonly default amazonwebservicesamazons victor k asked mar
841"how to inplace initialize std::array<std::pair<const key, val>>? i am trying to create a static map for where the type of the key is an enum, and the values and keys are stored inside an std::array. the below code works nicely for trivially copiable types, but ... c++stl valikund 67 asked jun 7, 2024 at 13:40","['c++', 'stl']",en,place initiative stdarray trying create static map type key num values keys stored inside stdarray code works nicely trivially capable types cstl valikund asked jun
842"extend inline typescript interface on function i have a pretty simple react component which takes a required prop, active. setting the inline interface for this one prop is quite simple. but now, i need to account for the other types of props that ... reactjstypescript grover. 4,388 asked oct 5, 2022 at 21:17","['reactjs', 'typescript']",en,extend inline typescript interface function pretty simple react component takes required prop active setting inline interface one prop quite simple need account types props reactjstypescript grove asked oct
843"how to remove trailing and leading whitespace for user-provided input in a batch file? i know how to do this when the variable is pre-defined. however, when asking for the user to enter in some kind of input, how do i trim leading and trailing whitespace? this is what i have so far: @... inputbatch-filewhitespacetrim oopoop 493 asked jun 8, 2010 at 23:06","['input', 'batch-file', 'whitespace', 'trim']",en,remove trailing leading whitespace userprovided input batch file know variable predefined however asking user enter kind input trim leading trailing whitespace far inputbatchfilewhitespacetrim poop asked jun
844"how can i create a deviations query? i wanted to write a query that would allow me to calculate deviations by the number of created orders. task: the query should look back 7 days and based on this data build a minimum allowable ... prometheusgrafana tur 23 asked jun 1, 2023 at 13:34","['prometheus', 'grafana']",en,create deviations query wanted write query would allow calculate deviations number created orders task query look back days based data build minimum allowable prometheusgrafana tur asked jun
845"node modules and package-lock.json files are not showing in my folder after installing the built in moodules i was trying to install express module in my folder and i runned the cammand in terminal then it is showing me it has been installed successfully but the problem is node_modules and package-lock.json ... node.jsexpressnode-modules aditya tiwari 1 asked aug 30, 2023 at 4:08","['node.js', 'express', 'node-modules']",en,node modules packagelockson files showing folder installing built modules trying install express module folder runner command terminal showing installed successfully problem nodemodules packagelockson nodejsexpressnodemodules anita toward asked aug
846"cursor ai / claude 3.7 - user api key rate limit exceeded [closed] i have subscribed to the ""pro"" version of cursor ($25 per month), as well as the ""pro"" version of claude 3.7 ($20 per month). i have configured claude api key in cursor and begin ... anthropiccursor-ai eugene goldberg 15.6k asked 2 hours ago","['anthropic', 'cursor-ai']",en,cursor ai claude user api key rate limit exceeded closed subscribed pro version cursor per month well pro version claude per month configured claude api key cursor begin anthropiccursorai eugene goldberg k asked hours ago
847"tabbar selected indicator doesn't display correctly so, i had the code working well, then all of a sudden, i came back to it, and the tabbar doesn't fill the entire screen and shows a small circle indicating that that tab has been selected. this is how ... fluttermobile-application noah 713 asked jan 11, 2024 at 8:20","['flutter', 'mobile-application']",en,abbr selected indicator display correctly code working well sudden came back abbr fill entire screen shows small circle indicating tab selected fluttermobileapplication noah asked jan
848"inserting data to a implicit many-to-many relationship in prisma i am building a website similar to linkedin/indeed and am facing difficulties when trying to update a job row when a user applies to a job. i am using nest.js, postgres and prisma as the orm. here are ... postgresqlnestjsmany-to-manyprismaunique-constraint the online lyceum 1 asked aug 21, 2023 at 13:48","['postgresql', 'nestjs', 'many-to-many', 'prisma', 'unique-constraint']",en,inserting data implicit manytomany relationship prism building website similar linkedinindeed facing difficulties trying update job row user applies job using nestjs posters prism postgresqlnestjsmanytomanyprismauniqueconstraint online lyceum asked aug
849"the referenced script on this behaviour (game object '<null>') is missing the referenced script on this behaviour (game object '<null>') is missing! how to find this missing script? however i have checked every single gameobject in my scene and none of them have a ... unity-game-engine ina 19.6k asked may 16, 2023 at 23:53",['unity-game-engine'],en,referenced script behaviour game object missing referenced script behaviour game object missing find missing script however checked every single gameobject scene none unitygameengine ina k asked may
850"prioritize numeric result in cte when more than one row per date i am working with time recording data and i have a problem when people have registered more than one thing in a day. an example of the data: date reason hours 2024-05-20 null null 2024-05-21 90011 1.4 ... sqlsql-server dorthe jakobsen 3 asked aug 19, 2024 at 13:04","['sql', 'sql-server']",en,prioritize numeric result te one row per date working time recording data problem people registered one thing day example data date reason hours null null sqlsqlserver north jakobsen asked aug
851"some anomalies in julia‘s range object? problem description let's consider the following function function simpson(f, a,b, n) h = (b-a)/n h2 = 2*h s = f(a) + 4*sum(f.((a+h):h2:(b-h))) + 2*sum(f.((a+h2):h2:(b-h2))) + f(b) return h*s/... julia marc j charpentier 31 asked jul 9, 2023 at 9:09",['julia'],en,anomalies julias range object problem description let us consider following function function simpsonf ab n h ban h h fa sumfahhbh sumfahhbh fb return hs julia marc j carpenter asked jul
852"firebase firestore permission denial i have an flutter app that talks to the same collection and everything works fine. however, i have another flutter app app which i have also added to firebase and done all the configuration as in the ... fluttergoogle-cloud-firestorefirebase-security joseph ofem 384 asked may 16, 2023 at 18:23","['flutter', 'google-cloud-firestore', 'firebase-security']",en,fishbase restore permission denial clutter app talks collection everything works fine however another clutter app app also added fishbase done configuration fluttergooglecloudfirestorefirebasesecurity joseph oem asked may
853"how to use web.scotty stream with resourcet? having touched haskell since 2013, i am writing a small web.scotty service to manage s3 bucket (with amazonka-2.0). the web.scotty part and amazonka was pretty clear, but i am not sure how to make it ... haskellconduitscotty m0nhawk 24.3k asked nov 10, 2023 at 20:29","['haskell', 'conduit', 'scotty']",en,use webscott stream resources touched haskell since writing small webscott service manage bucket amazon webscott part amazon pretty clear sure make haskellconduitscotty mhawk k asked nov
854"finishing closed test on google play console how do i conclude alpha closed testing for my app on google play console? i'm looking for step-by-step guidance to properly finish the alpha testing phase and transition to the next stage. any ... google-play-console azolite land 11 asked mar 6, 2024 at 14:58",['google-play-console'],en,finishing closed test google play console conclude alpha closed testing app google play console looking stepbystep guidance properly finish alpha testing phase transition next stage googleplayconsole polite land asked mar
855"how to give minute in fixeddelay & initialdelay in @scheduled spring boot? i am new for scheduler in spring. i read so many articles on @schedule but in every example they gave time in seconds and milliseconds. problem statement : as per my requirement, after my program ... javaspringspring-bootscheduler vijayk 2,763 asked may 12, 2020 at 10:49","['java', 'spring', 'spring-boot', 'scheduler']",en,give minute fixeddelay initialdelay scheduled spring boot new schedule spring read many articles schedule every example gave time seconds milliseconds problem statement per requirement program javaspringspringbootscheduler vijay asked may
856"trying to convert an mp4 to webp with ffmpeg with different lossless/compression settings, but getting the same result i am trying to convert an mp4 video to webp. i am trying different -lossless and -compression_level settings (as described here), but all the output videos have identical disk size. -lossless can ... ffmpegmp4webp corgrath 12.3k asked aug 5, 2021 at 10:14","['ffmpeg', 'mp4', 'webp']",en,trying convert mp web mpeg different lossescompression settings getting result trying convert mp video web trying different losses compressionlevel settings described output videos identical disk size losses ffmpegmpweb corgrath k asked aug
857"how to run .sql files in vscode on .csv files how do i run .sql files in vscode on .csv files? tried all extensions, i dont want to use a database i just want to run my .sql file and the query to get data from the .csv file i want to do something ... databasesqlitecsv hello 1 asked jan 27, 2024 at 22:44","['database', 'sqlite', 'csv']",en,run sql files uscode csv files run sql files uscode csv files tried extensions want use database want run sql file query get data csv file want something databasesqlitecsv hello asked jan
858"how can i run next.js with self hosted node js? i'm new to next.js and my goal is to achieve ssr (server side rendering) with my react web app. i would like to host it on my own vps. everything is dandy running it locally but when i setup a ci ... node.jsreactjsnext.jsdeployment artur kedzior 4,273 asked apr 27, 2023 at 14:54","['node.js', 'reactjs', 'next.js', 'deployment']",en,run nextjs self hosted node js new nextjs goal achieve ssr server side rendering react web app would like host vs everything sandy running locally setup ci nodejsreactjsnextdeployment artuk kedzior asked apr
859"fixing out of sync warning in argo cd - unable to ignore the optional `preserveunknownfields` field argo cd shows two items from linkerd (installed by helm) are being out of sync. the warnings are caused by the optional preserveunknownfields: false in the spec section: trafficsplits.split.smi-spec.... kubernetesjsonpathargocdlinkerdjsonpointer redgiant 4,769 asked may 18, 2021 at 5:50","['kubernetes', 'jsonpath', 'argocd', 'linkerd', 'jsonpointer']",en,fixing sync warning ago cd unable ignore optional preserveunknownfields field ago cd shows two items linked installed helm sync warnings caused optional preserveunknownfields false spec section trafficsplitssplitsmispec kubernetesjsonpathargocdlinkerdjsonpointer reliant asked may
860"aws api gateway custom authorizer not invoked to start off with, i am pretty new to aws. started with pretty basic api gateway + lambda integration. below are my use cases. created a lambda proxy integration request with api gateway, get request ... amazon-web-servicesaws-lambdaaws-api-gateway amit 555 asked sep 28, 2018 at 6:26","['amazon-web-services', 'aws-lambda', 'aws-api-gateway']",en,aws api gateway custom authorized invoked start pretty new aws started pretty basic api gateway lambda integration use cases created lambda proxy integration request api gateway get request amazonwebservicesawslambdaawsapigateway mit asked sep
861"@media print move element to the last page on a website i have an img-carousel and carousel-indicators which are basically img-thumbnails. i want to create a print-version where the structure is div.one (carousel) - only the currently active ... javascriptcsscss-paged-mediacss-print yaerox 678 asked apr 4, 2024 at 11:56","['javascript', 'css', 'css-paged-media', 'css-print']",en,media print move element last page website imgcarousel carouselindicators basically imgthumbnails want create printversion structure divone carousel currently active javascriptcsscsspagemediasprint aero asked apr
862"autosar rule a5-0-4 stance on pointer arithmetic autosar rule a5-0-4 states pointer arithmetic shall not be used with pointers to non-final classes. it provides the following rationale: pointer arithmetic is only well defined if the pointed-to ... c++polymorphismautosar iwarv 441 asked oct 27, 2023 at 17:31","['c++', 'polymorphism', 'autosar']",en,autor rule stance pointer arithmetic autor rule states pointer arithmetic shall used pointers nonfinal classes provides following rationale pointer arithmetic well defined pointedto cpolymorphismautosar war asked oct
863"i have a two gpu nvidia driver showing it's one gpu id using python code on ubuntu i have a 2 a100 pcie (80gb vram) gpu but nvidia is giving me on visible gpu is 1. such as a 0 index gpu and i am unable to get the 1 index gpu on ubuntu server. here is the code result pytorch image ... pythonpytorchgpulinux-device-drivernvidia faizan munsaf 1 asked jan 9, 2024 at 7:20","['python', 'pytorch', 'gpu', 'linux-device-driver', 'nvidia']",en,two gpu india driver showing one gpu id using python code ubuntu pie gb tram gpu india giving visible gpu index gpu unable get index gpu ubuntu server code result pwtorch image pythonpytorchgpulinuxdevicedrivernvidia taiwan unsafe asked jan
864"is there a way to keep recording after pausing expo-audio? i'm unable to achieve this whatsapp-like voice message recording, i want the user to be able to record and pause without limit as well as listen to what has been recorded, to finally send one whole ... reactjsreact-nativeexpoexpo-av immerhaze 71 asked nov 28, 2023 at 17:59","['reactjs', 'react-native', 'expo', 'expo-av']",en,way keep recording passing expoaudio unable achieve whatsapplike voice message recording want user able record pause without limit well listen recorded finally send one whole reactjsreactnativeexpoexpoav immerhaze asked nov
865"script to run saved search and render in pdf template i have a use case where we need to create a saved search and an advanced pdf template to go with it. i need a script to run the search and render the custom pdf template i made. it seems like this is ... netsuitesuitescriptsuitescript2.0 bill_meister 1 asked aug 29, 2023 at 21:03","['netsuite', 'suitescript', 'suitescript2.0']",en,script run saved search render pdf template use case need create saved search advanced pdf template go need script run search render custom pdf template made seems like netsuitesuitescriptsuitescript billmister asked aug
866"trying to parse an uploaded pdf to split into chunks using langchain's import { recursivecharactertextsplitter } from 'langchain/text_splitter'; import { webpdfloader } from 'langchain/document_loaders/web/pdf'; import * as pdfjs from 'pdfjs-dist'; ///...code here ... openai-apipdf.jslangchainpdfjs-distlangchain-js artario 1 asked dec 29, 2023 at 0:03","['openai-api', 'pdf.js', 'langchain', 'pdfjs-dist', 'langchain-js']",en,trying parse uploaded pdf split chunks using langchains import recursivecharactertextsplitter langchaintextsplitter import webpdfloader langchaindocumentleaderswebpdf import pdfs pdfsdist code openapipdfjslangchainpdfjsdistlangchainjs ontario asked dec
867"grafana ""invalid username or password"" on localhost runnning grafana on https://localhost:3000, my password seems to have stopped working. i tried resetting the admin password with grafana-cli --homepath /usr/local/share/grafana admin reset-admin-... grafana m3rs 7,600 asked dec 10, 2021 at 10:42",['grafana'],en,granada invalid username password localhost running granada password seems stopped working tried setting admin password granadacli homepage usrlocalsharegranada admin resetadmin granada mrs asked dec
868"type safety doesn't work with angular dependency injection i lose typing when i use angular's dependency injection. i don't know why? can someone explain and find a solution to use di while having strict typing? i'm using a service to strictly type local ... angulartypescriptdependency-injectiontype-safety tim 396 asked sep 27, 2023 at 0:51","['angular', 'typescript', 'dependency-injection', 'type-safety']",en,type safety work angular dependency injection lose typing use angulars dependency injection know someone explain find solution use di strict typing using service strictly type local angulartypescriptdependencyinjectiontypesafety tim asked sep
869"python: how do you specify the parameter type of a class function to the current class? i'm writing a set of custom classes with inheritance using python. here is the code, simplified: class parent(object): __slots__ = ['a','b'] def __init__(self, a:int, b:int): self.a = ... pythonclassinheritancetypesoverloading cukee8 61 asked dec 6, 2021 at 3:39","['python', 'class', 'inheritance', 'types', 'overloading']",en,python specify parameter type class function current class writing set custom classes inheritance using python code simplified class parentobject slots ab def initself bint selfa pythonclassinheritancetypesoverloading curve asked dec
870"kotlin map with non null values let say that i have a map for translating a letter of a playing card to an integer val rank = mapof(""j"" to 11, ""q"" to 12, ""k"" to 13, ""a"" to 14) when working with the map it seems that i always have ... collectionskotlin tomas karlsson 765 asked mar 9, 2017 at 21:28","['collections', 'kotlin']",en,koeln map non null values let say map translating letter playing card integer val rank mapj q k working map seems always collectionskotlin tomas carlson asked mar
871"npm err! code e404 while installing react packages while building a typescript based fullstack project i am getting the following error npm err! code e404 npm err! 404 not found - get https://registry.npmjs.org/@mui%2ficon-material - not found npm err!... reactjstypescriptmaterial-uidatepickernivo-react saksham jain 40 asked nov 28, 2023 at 13:38","['reactjs', 'typescript', 'material-ui', 'datepicker', 'nivo-react']",en,num err code e installing react packages building typescript based fullback project getting following error num err code e num err found get found num err reactjstypescriptmaterialuidatepickernivoreact rakshak jain asked nov
872"how to fix style attribute not found in xamarin project there are two xml files referencing color in the xamarin project with visual studio: styles.xml: <resources> <!-- base application theme. --> <style name=""apptheme"" parent=... androidxamarin ron 2,503 asked aug 7, 2023 at 17:28","['android', 'xamarin']",en,fix style attribute found marin project two xml files referencing color marin project visual studio stylesxml style nameapptheme parent androidxamarin ron asked aug
873"why cygwin add current project path as a prefix to cmake include path after learning c++ recently, i faced a challenge while using boost in a cmake project. i made some configurations in my cmakelists.txt file and didn't receive any errors from cmake. however, i keep ... c++cmakeboostcygwinclion fade 35 asked jan 26, 2024 at 3:18","['c++', 'cmake', 'boost', 'cygwin', 'clion']",en,cyclin add current project path prefix make include path learning c recently faced challenge using boost make project made configurations cmakeliststxt file receive errors make however keep ccmakeboostcygwinclion fade asked jan
874"is there a way to get the code from a pkl file (it's the model's weights) enter image description here in a project i'm working on, i have access only to the pickled model files — specifically, six chunked .pkl files (e.g., model_chunk_0.pkl, ..., model_chunk_5.pkl). these ... artificial-intelligencelarge-language-modelpkl kawtar 1 asked apr 21 at 11:17","['artificial-intelligence', 'large-language-model', 'pkl']",en,way get code pl file models weights enter image description project working access pickled model files specifically six checked pl files eg modelchunkpl modelchunkpl artificialintelligencelargelanguagemodelpkl altar asked apr
875"node + mysql - how to get the raw query with bindings is it possible to get the raw sql query with its bindings either prior or after execution to see what's about to, or has just executed? example: const id = 4 const connection = await fastify.mysql.... node.jsnode-mysqlfastifynode-mysql2 dally 1,467 asked may 17, 2023 at 16:52","['node.js', 'node-mysql', 'fastify', 'node-mysql2']",en,node get raw query bindings possible get raw sql query bindings either prior execution see executed example const id const connection await justifymyself nodenodemysqlfastifynodemyself daily asked may
876"is there an alternative to the err specifier in a fortran read() statement? in this code read(unit,'i0',err=100) my_integer 100 error_stop ""something went wrong."" the err specifier tells the program to go to the statement labeled 100 if something went wrong in ... error-handlingfile-iofortran byl 77 asked 2 days ago","['error-handling', 'file-io', 'fortran']",en,alternative err specified portray read statement code readunitierr myinteger errorstop something went wrong err specified tells program go statement labeled something went wrong errorhandlingfileiofortran byl asked days ago
877"""the provided key element does not match the schema"" error when getting an item from dynamodb this is the table partition key setting the table content when i tried to get an item from the table, it prints this error botocore.exceptions.clienterror: an error occurred (validationexception) ... pythonamazon-dynamodbboto3 keoros 1,387 asked mar 13, 2017 at 6:46","['python', 'amazon-dynamodb', 'boto3']",en,provided key element match schema error getting item dynamo table partition key setting table content tried get item table prints error boxscoreexceptionsclienterror error occurred validationexception pythonamazondynamodbboto euros asked mar
878"brew installation of numpy is not working i installed numpy with brew as seen here: (venv6) me:pcode me$ brew install numpy ==> downloading https://formulae.brew.sh/api/formula.jws.json ==> downloading https://formulae.brew.sh/api/cask.... homebrew bobsmith76 294 asked jan 19, 2024 at 0:51",['homebrew'],en,brew installation num working installed num brew seen vent mepcode brew install num downloading downloading hombre dpbsmith asked jan
879"lazycolumn started showing indexoutofboundsexeption on list size change lazycolumn stopped recomposing correctly on list size decrease showing indexoutofboundsexeption. here is test code i am trying inside my project val data = remember { mutablestateof( listof(&... android-jetpack-composekotlin-flow oljik 31 asked oct 29, 2023 at 12:13","['android-jetpack-compose', 'kotlin-flow']",en,lazycolumn started showing indexoutofboundsexeption list size change lazycolumn stopped composing correctly list size decrease showing indexoutofboundsexeption test code trying inside project val data remember mutablestateof list androidsetbackcomposekotlinflow oldid asked oct
880"can a nuget.client restorecommand specify explictly to ignore all dependencies? in a standalone c# app that uses nuget.client, i'm trying to build a restorecommand that restores just a package, and no dependencies at all. i know there is dependencybehavior.ignore but i cannot ... c#nuget remus rusanu 295k asked jun 20, 2024 at 6:11","['c#', 'nuget']",en,nuggetclient restorecommand specify explicitly ignore dependencies standalone c app uses nuggetclient trying build restorecommand restores package dependencies know dependencybehaviorignore cannot cnugget genus susan k asked jun
881"postman equivalent of --upload-file option in curl i am using signed url to upload files to gcp cloud storage. with curl, the upload is working fine: curl -x put -h 'content-type: text/csv' --upload-file audience.csv <signed-url> however, if i ... google-cloud-platformcurlpostmangoogle-cloud-storage vijayst 22k asked aug 24, 2023 at 1:48","['google-cloud-platform', 'curl', 'postman', 'google-cloud-storage']",en,postal equivalent uploadfile option curl using signed url upload files gap cloud storage curl upload working fine curl x put h contenttype textcsv uploadfile audiencecsv however googlecloudplatformcurlpostmangooglecloudstorage vijay k asked aug
882"hyperref package: how to color citations only i would like to use the hyperref package to color citations only, but it seems that it colors every link. for example here: \documentclass{article} \usepackage{hyperref} \hypersetup{ ... latexbeamer andros 103 asked mar 17, 2022 at 10:18","['latex', 'beamer']",en,hyperref package color citations would like use hyperref package color citations seems colors every link example documentclassarticle usepackagehyperref hypersetup latexbeamer andres asked mar
883"in what order are expressions evaluated in a test clause of if or when? [duplicate] in what order is an if or when expression evaluated? in this real life example <xsl:when test=""(wd:worker_group/wd:costngallcexists = '1') and exists(wd:worker_group/wd:costngallcexists) and (... xmlxslt joem 39 asked may 22, 2024 at 15:01","['xml', 'xslt']",en,order expressions evaluated test clause duplicate order expression evaluated real life example xslwhen testwdworkergroupwdcostngallcexists existswdworkergroupwdcostngallcexists xmlxslt poem asked may
884"powershell script function select and saveas i have a script what should do the following: open a file with a dialog box and save the selected file as a compressed archive and automaticly create the output on a destination (say c:\temp) the ... powershellopenfiledialog terror death 3 asked jul 30, 2024 at 6:02","['powershell', 'openfiledialog']",en,powershell script function select saves script following open file dialog box save selected file compressed archive automatically create output destination say ctemp powershellopenfiledialog terror death asked jul
885"japanese standard web fonts i am working on a japanese website and have a hard time finding a font which looks good in japanese. i was surprised that so few fonts seem to exist for japanese. my team has contacted several web ... cssfontsmultilingualwebfonts mattias örtenblad 686 asked jan 28, 2013 at 13:26","['css', 'fonts', 'multilingual', 'webfonts']",en,japanese standard web fonts working japanese website hard time finding font looks good japanese surprised fonts seem exist japanese team contacted several web cssfontsmultilingualwebfonts matias ortenblad asked jan
886"can i delete aps environment for icloud i want to store a public database on icloud that serves key-value configurations (similar to firebase's remote config). when i enable icloud in xcode ""signing & capabilities"" tab, i see ... iosicloudcloudkitaps hl666 105 asked 2 days ago","['ios', 'icloud', 'cloudkit', 'aps']",en,delete aps environment cloud want store public database cloud serves keyvalue configurations similar fishbases remote config enable cloud code signing capabilities tab see iosicloudcloudkitaps hl asked days ago
887"how to write the correct comment to receive request body block with no param definition trying to receive this but i get this: my comment for handler: // @summary проверка checkproof // @description **проверка checkproof** // @tags tonproof // @accept json // @... goswagger ilya 11 asked may 27, 2024 at 7:58","['go', 'swagger']",en,write correct comment receive request body block param definition trying receive get comment handler summary proverka checkproof description proverka checkproof tags tonproof accept son goswagger ila asked may
888"powershell locate and load package .dll using powershell and the ical.net package, i want to read an .ics file. # install ical.net dependencies install-package nodatime -force # install ical.net package install-package ical.net -force # ... powershellnugetpackage-management aristosv 107 asked feb 22, 2023 at 18:24","['powershell', 'nuget', 'package-management']",en,powershell locate load package using powershell calnet package want read ics file install calnet dependencies installpackage nodatime force install calnet package installpackage calnet force powershellnugetpackagemanagement aristosv asked feb
889"changes in css-file don't affect react-slick i'm trying to change the styles of react-slick carousel that i use in my gatsbyjs project. in my slider component i import the library the way it's shown in the official docs: import slider from ""... node.jsreactjsreact-slick scripter2021 391 asked mar 19, 2022 at 18:45","['node.js', 'reactjs', 'react-slick']",en,changes cssfile affect reactslick trying change styles reactslick carousel use gatsbyjs project slider component import library way shown official docs import slider nodejsreactjsreactslick scripted asked mar
890"rundeck trigger job via api without exposing script is there a way to permit a user to trigger a rundeck job via api without exposing the script? this seems to be the default in the http reply i get from rundeck. example: curl -x ""post"" -h &... linuxbashcurlrundeck senkel 3 asked feb 27, 2023 at 13:35","['linux', 'bash', 'curl', 'rundeck']",en,runde trigger job via api without exposing script way permit user trigger runde job via api without exposing script seems default http reply get runde example curl x post h linuxbashcurlrundeck sense asked feb
891"using lingui with dynamic form generator i have a dynamic form generator which accepts json object, and then creates a form with its fields. json objects consist of separate objects each describing form fields. i am trying to use lingui to ... localizationreact-i18nextdynamic-formslinguijs ahmed elbessfy 145 asked jun 5, 2024 at 15:13","['localization', 'react-i18next', 'dynamic-forms', 'linguijs']",en,using lingua dynamic form generator dynamic form generator accepts son object creates form fields son objects consist separate objects describing form fields trying use lingua localizationreactinextdynamicformslinguijs ahmed elbessfy asked jun
892"flutter : space between slidableaction is it possible to have a space between slidableaction and its child on flutter_slidable: ^3.0.1 ? like a margin rigth for the green part. slidableaction and its child thanks this the code child: ... flutterdart adrien bernard 1 asked nov 30, 2023 at 11:31","['flutter', 'dart']",en,clutter space slidableaction possible space slidableaction child cluttersuitable like margin right green part slidableaction child thanks code child flutterdart adrian bernard asked nov
893"workerservice configure a rabbitmq with masstransit in a workerservice .net i am trying to configure a masstransit host with rabbitmq but i am getting this error reference to type 'ibuscontrol' claims it is defined in 'masstransit', but it could not ... dependency-injectionrabbitmqmasstransit elias ghali 863 asked may 27, 2022 at 9:53","['dependency-injection', 'rabbitmq', 'masstransit']",en,workerservice configure rabbit masstransit workerservice net trying configure masstransit host rabbit getting error reference type ibuscontrol claims defined masstransit could dependencyinjectionrabbitmqmasstransit elias goals asked may
894"arango orm to pydantic i'm transferring my code from arango-orm to pydantic. my question is how to write the collection, graph, edge, relation classes in pydantic. please guide. thank you. i also tried to install ... pythonarangodbpydantic tmalik 1 asked aug 4, 2023 at 12:34","['python', 'arangodb', 'pydantic']",en,range pedantic transferring code rangeor pedantic question write collection graph edge relation classes pedantic please guide thank also tried install pythonarangodbpydantic malik asked aug
895"cypress: passing the param into npm script when run by cl i tryna pass the param param1 and param2 when i run the script by command line. here code in test.cy.js it('clean data', () => { const param1 = process.env.npm_config_param1; const param2 =... javascriptcypresscypress-custom-commands hnhu 137 asked may 3, 2023 at 8:52","['javascript', 'cypress', 'cypress-custom-commands']",en,cypress passing param num script run cl try pass param param param run script command line code testcyjs itclean data const param processenvnumconfigparam const param javascriptcypresscypresscustomcommands nhu asked may
896"not seeing any speedup when multiprocessing c++ code in python? i have some python code, which relies on a piece of c++ code that essentially does a large tree search. i need to run this tree search n times in a for loop and since each iteration was taking several ... pythonc++performancemultiprocessing tue 440 asked mar 6, 2024 at 13:54","['python', 'c++', 'performance', 'multiprocessing']",en,seeing speed multiprocessing c code python python code relies piece c code essentially large tree search need run tree search n times loop since iteration taking several pythonperformancemultiprocessing tue asked mar
897"is it possible to edit the shape of a ""polygon2d"" node that is nested within an ""area2d"" scene from the 2d editor? first post so please go easy on me! i'm working on porting a board game into godot as a learning project. the board game map is made up of a number of irregular polygons (some convex, some concave). ... godotgodot4 luke sills 11 asked dec 20, 2023 at 15:30","['godot', 'godot4']",en,possible edit shape polygond node nested within aread scene editor first post please go easy working sorting board game odot learning project board game map made number irregular polygons convex concave godotgodot luke sills asked dec
898"python healpy mollview scatter subplots show up in all subfigures i'm trying to plot two subplots of hp.mollview projections with scatterplots, the first scatterplot shows up in the correct subfigure. but the second scatterplot shows up in both subfigures. the code ... pythonhealpy themercury79 45 asked jul 30, 2023 at 7:10","['python', 'healpy']",en,python help mollview scatter subplot show subfigures trying plot two subplot hpmollview projections scatterplots first scatterplot shows correct subfigure second scatterplot shows subfigures code pythonhealpy themercury asked jul
899"realtime output using python subprocess of script with read prompts i have a bash script which interacts with the user using read prompts, for example: #!/bin/bash echo start read -p ""press something to continue "" -n 1 -r echo got $reply. read -p "" ... pythonshellsubprocess user1656308 13 asked oct 19, 2023 at 6:46","['python', 'shell', 'subprocess']",en,realtime output using python subprocess script read prompts bash script interacts user using read prompts example binbash echo start read p press something continue n r echo got reply read p pythonshellsubprocess user asked oct
900"how to add memory to llama 4 while using it through cmd using groq api? i tried adding a ai on a batch file, but the problem is every time i write a new statement, the command overwrites all the text, hence i am not able to access previous memories. @echo off setlocal ... jsonbatch-filememorycommand-promptgroq hacxer_2016 1 asked apr 20 at 18:09","['json', 'batch-file', 'memory', 'command-prompt', 'groq']",en,add memory lama using cmd using grow api tried adding ai batch file problem every time write new statement command overrides text hence able access previous memories echo setlocal jsonbatchfilememorycommandpromptgroq hacker asked apr
901"running any exe with jsch in a aws windows server not working we have a windows server in aws and we are interacting using jsch. we are able to write a file there. we can also execute this command: tasklist | findstr myprogram to check if myprogram is running ... jsch ángel fas 373 asked feb 9, 2024 at 21:12",['jsch'],en,running exe sch aws windows server working windows server aws interacting using sch able write file also execute command tracklist finds program check program running sch angel fas asked feb
902"vba project, copy enabled labels and textboxes from a userform to another userform i have a vba project. there are two userforms. on the first userform, i chose some of them to be enabled and input a value in the respective text box. then when i press the next button, it should ... excelvba hosesf 1 asked jan 31, 2024 at 15:26","['excel', 'vba']",en,via project copy enabled labels textbooks perform another perform via project two performs first perform chose enabled input value respective text box press next button excelvba houses asked jan
903"regex to find lines that do not contain captured group i am trying to find logging lines in a project that log a throwable incorrectly. examples of correct and incorrect usage: // correct catch (exception e) { log.error(classname, ""something went ... javaregexintellij-idea earthturtle 355 asked dec 14, 2023 at 20:15","['java', 'regex', 'intellij-idea']",en,regex find lines contain captured group trying find logging lines project log throwable incorrectly examples correct incorrect usage correct catch exception e logerrorlastname something went javaregexintellijidea earthturtle asked dec
904"need to convert string to array of objects in single jolt input json { ""systemname"": ""[\""r342\"",\""eefcp\"",\""sblll\"",\""now\"",\""sllv\"",\""cxlx\"",\""es\"",\""sc\""]""... jsonjolt karthik 21 asked apr 10, 2024 at 13:49","['json', 'jolt']",en,need convert string array objects single bolt input son systemname reefsmallnowsllcolessc jsonjolt karthik asked apr
905"is this a bug in visual studio with modules? make a module file: export module mymodule; #include <iostream> then in main.cpp (not a module): import mymodule; #include <vector> int main(void) { return 0; } compiling in either ... c++visual-studio zebrafish 15.1k asked dec 2, 2023 at 13:20","['c++', 'visual-studio']",en,bug visual studio modules make module file export module module include maincpp module import module include int mainvoid return compiling either cvisualstudio zebrafish k asked dec
906"c# decoding string with possible custom logic i have the following line in a file (å\x9c°å\x9d\x803)7sj686ä¿\x9dæ\x8a¤è£\nç½®v1.00.log and i know this is supposed to represent (地址3)7sj686保护装置v1.00.log but i've not been able to use the right ... c#character-encoding fest 883 asked aug 30, 2023 at 23:44","['c#', 'character-encoding']",en,c decoding string possible custom logic following line file axcdegaxdxsjaxdaexaePSnc registeredvlog know supposed represent Di Zhi sjBao Hu Zhuang Zhi vlog able use right ccharacterencoding fest asked aug
907"how to keep a window created with pyside6 always on top of the windows 11 taskbar? i am trying to create a window to display hardware information, and the window needs to always stay on top of the windows 11 taskbar. however, whenever i click on the taskbar or the start button, the ... pyside6 jack 1 asked 22 hours ago",['pyside6'],en,keep window created side always top windows taskbar trying create window display hardware information window needs always stay top windows taskbar however whenever click taskbar start button side jack asked hours ago
908"cannot access private key via code for .net generated certificate, but can with open ssl generated certificate i want to be able to generate ca root and server certificates using .net. the end goal is to use these to secure inter-service grpc comms, but right now everything is running locally. when i generate ... c#.netopensslx509certificate2 ste-fu 7,497 asked 23 hours ago","['c#', '.net', 'openssl', 'x509certificate2']",en,cannot access private key via code net generated certificate open ssl generated certificate want able generate ca root server certificates using net end goal use secure interservice grc comms right everything running locally generate cnetopensslxcertificate stefu asked hours ago
909"nextjs middleware to tackle matcher i am running a middleware in my nextjs for blog with below matcher matcher: [""/blog/:path*"", ""/_tenants/:path*""], my articles page has the route /blog/slug-uuid i have list page ... next.js shaham ahmed 11 asked may 26, 2023 at 10:58",['next.js'],en,next middleware tackle matches running middleware next blog matches matches blogpath tenantspath articles page route blogsluguuid list page nextjs shah ahmed asked may
910"how are keycloak roles managed? keycloak is a great tool, but it lacks proper documentation. so we have realm.roles, client.roles and user.roles how do there 3 work together when accessing an application using a specific client? ... keycloakkeycloak-services olivier refalo 51.6k asked dec 15, 2017 at 18:01","['keycloak', 'keycloak-services']",en,keycloak roles managed keycloak great tool lacks proper documentation realmroles clientroles userroles work together accessing application using specific client keycloakkeycloakservices olivier real k asked dec
911"set process.env.node_env in nodejs i need to set process.env.node_env to 'production' in local nestjs code. steps i tried- in package.json for the serve script i added node_env=production in package.json for the build script added nx ... node.jsangularnestjsnx-monorepo nitin 31 asked jun 29, 2023 at 11:12","['node.js', 'angular', 'nestjs', 'nx-monorepo']",en,set processenvnodeenv nodes need set processenvnodeenv production local nests code steps tried packageson serve script added nodeenvproduction packageson build script added nx nodejsangularnestjsnxmonorepo within asked jun
912"oracle apex 22.1 ig save validations i have an ig: select emp_name, dept_name, bu, org_unit from emp_organizations; i want to add validations such that when a new record is created app should check if dept_name exists in the database. ... oracle-apex velocity 475 asked jun 20, 2024 at 6:34",['oracle-apex'],en,oracle apex ig save validation ig select empname deptname bu orgunit emporganizations want add validation new record created app check deptname exists database oracleapex velocity asked jun
913"is it possible to record meetings through alexa? i want to record some public events through alexa. is this possible? as far as i know alexa only records on a dvr. how can i tell alexa to record the specific event on a specific dvr? does this ... alexa-skills-kit dev0893 1 asked feb 5, 2024 at 11:54",['alexa-skills-kit'],en,possible record meetings alexa want record public events alexa possible far know alexa records dvr tell alexa record specific event specific dvr alexaskillskit dev asked feb
914"how to integrate adobe product recommendations sdk in angular 8? [closed] i'm working on integrating adobe product recommendations sdk into an angular 8 application. i've installed both: `@magento/recommendations-js-sdk @adobe/magento-storefrontend-events-sdk` however, all ... angularmagentoadoberecommendation-engine waqar ahmad 137 asked 2 days ago","['angular', 'magento', 'adobe', 'recommendation-engine']",en,integrate adobe product recommendations sdk angular closed working integrating adobe product recommendations sdk angular application installed magentarecommendationsjssdk adobemagentastorefrontendeventssdk however angularmagentoadoberecommendationengine water ahmad asked days ago
915"delete a closed track in google play console in the app releases page of the google play console, how do you delete a closed track? there is a manage button for the track but no obvious way of deleting it from the page which appears. i have ... google-playgoogle-play-console hughhughteotl 5,819 asked jul 12, 2018 at 7:58","['google-play', 'google-play-console']",en,delete closed track google play console app releases page google play console delete closed track manage button track obvious way deleting page appears googleplaygoogleplayconsole hughhughteotl asked jul
916"facing issues with speaker audio going into mic for an interruptible voice bot in chrome i am making a voice bot, which can be interrupted while speaking. i am using webaudio apis to get the float32 array of samples, to calculate average amplitude. if this crosses a certain threshold, ... javascriptaudioweb-audio-api user3279692 339 asked apr 21 at 11:06","['javascript', 'audio', 'web-audio-api']",en,facing issues speaker audio going mic interruptible voice bot chrome making voice bot interrupted speaking using webaudio apps get float array samples calculate average amplitude crosses certain threshold javascriptaudiowebaudioapi user asked apr
917"react - getting a component from a dom element for debugging for the purposes of debugging in the console, is there any mechanism available in react to use a dom element instance to get the backing react component? this question has been asked previously in the ... javascriptreactjs loderunner28 1,866 asked mar 28, 2015 at 19:44","['javascript', 'reactjs']",en,react getting component dom element debugging purposes debugging console mechanism available react use dom element instance get backing react component question asked previously javascriptreactjs forerunner asked mar
918"how can i replace a video with a placeholder image so that the video loads after the dom? consider this website that consists of a hero video on top and some content below. <body class=""d-flex static_pages-index flex-column""> <div class=""w-100 flex-shrink-0""&... javascripthtmlvideolazy-loading cjoerg 1,325 asked apr 12, 2023 at 14:14","['javascript', 'html', 'video', 'lazy-loading']",en,replace video placeholder image video loads dom consider website consists hero video top content div classw flexshrink javascripthtmlvideolazyloading cjoerg asked apr
919"trying to do an optimization with 3 variables in openmdao i am trying to add a third variable in my problem with np but it seems to not work, like the optimization is failing but the code is working so i don't really know what to do. i don't know if i should ... optimizationopenmdao simon boudoux 21 asked may 15, 2024 at 14:52","['optimization', 'openmdao']",en,trying optimization variables openmdao trying add third variable problem problem seems work like optimization failing code working really know know optimizationopenmdao simon boudoux asked may
920"check string (excel) i want to check text (ignore upper case ,lower case , use wildcard first text and end text , ignore space) example compare text ""test sample round2"" with ""test sample"" ---> i ... excelvba stef 1 asked feb 16, 2024 at 7:37","['excel', 'vba']",en,check string excel want check text ignore upper case lower case use wildcard first text end text ignore space example compare text test sample round test sample excelvba step asked feb
921"alternative for <blink> the <blink> tag was never an official standard, and is now completely abandoned by all browsers. is there a standards compliant way of making text blink? html jobukkit 2,700 asked aug 7, 2013 at 13:46",['html'],en,alternative tag never official standard completely abandoned browsers standards compliant way making text blink html jobukkit asked aug
922"vite react app deploy to azure app services fails i'm trying to deploy my vite react app to azure as an app service, but after deploy i always get the default screen (see picture). i tried deploying manually from vs code, but also creating the ... reactjsazureazure-web-app-servicedevops samivagyok 61 asked jan 16, 2023 at 15:47","['reactjs', 'azure', 'azure-web-app-service', 'devops']",en,site react app deploy azure app services fails trying deploy site react app azure app service deploy always get default screen see picture tried deploying manually vs code also creating reactjsazureazurewebappservicedevops samivagyok asked jan
923"how to create additional options for a specific block i created a plugin that has a gutenberg block created with react, my block consists of the following files (edit.js, save.js, index.js, block.json, style.scss, editor.scss). this plugin has many ... reactjsblockwordpress-gutenberg denis 13 asked mar 26, 2024 at 23:00","['reactjs', 'block', 'wordpress-gutenberg']",en,create additional options specific block created plugin gutenberg block created react block consists following files editjs savejs indexjs blockson stylecss editorcss plugin many reactjsblockwordpressgutenberg denis asked mar
924"cv2.imshow() function isn't displaying anything when i call it i'm following one of the opencv python tutorials on displaying a live video feed from your camera. when i run the program, the green light for the webcam comes on (as i'm on a mac) and there aren't ... pythonopencv the all time cow tomlinson 21 asked nov 22, 2020 at 21:13","['python', 'opencv']",en,cvshow function displaying anything call following one open python tutorials displaying live video feed camera run program green light webcam comes mac pythonopencv time cow tomlinson asked nov
925"what does the '@' symbol do in rust? i forgot to specify the type of a parameter and the error message was as follows: error: expected one of `:` or `@`, found `)` --> src/main.rs:2:12 | 2 | fn func(arg) | ^ expected ... rust michael francis 8,777 asked apr 18, 2018 at 18:18",['rust'],en,symbol rust forgot specify type parameter error message follows error expected one found srcmainrs fn funcarg expected rust michael francis asked apr
926"how to upload files to github via vs code [duplicate] i am currently working on large files (~2gb). and i want to upload to github repository created by my collaborator, but i fail to push several times. here is the error messages from git push origin ... gitvisual-studio-codegithub ken hsu 437 asked 2 days ago","['git', 'visual-studio-code', 'github']",en,upload files github via vs code duplicate currently working large files gb want upload github repository created collaborator fail push several times error messages git push origin gitvisualstudiocodegithub ken hu asked days ago
927"why is this concurrent code slower than the serial code? (go) [closed] i wanted to try using a concurrent solution to problem 206 (reverse a linked list) on leetcode, so i wrote this: func reverselist(head *listnode) *listnode { var prev, temp *listnode cur, ch :=... performancegoconcurrencybenchmarkinggoroutine boris kaptsanov 62 asked feb 9, 2024 at 11:43","['performance', 'go', 'concurrency', 'benchmarking', 'goroutine']",en,concurrent code slower serial code go closed wanted try using concurrent solution problem reverse linked list leetcode wrote func reverselisthead listnode listnode var prev temp listnode cur ch performancegoconcurrencybenchmarkinggoroutine boris kaptsanov asked feb
928"publish a nuxt 3 app/components on npm that is usable by normal vue 3 without nuxt the usual way for me publishing a vue component is based on this video. and for nuxt 3, the workflow is way easier, almost nothing much to configure just npm publish and then just install the package, ... nuxt.jsvuejs3nuxt3.jsnpm-publish aleng 438 asked oct 19, 2023 at 11:04","['nuxt.js', 'vuejs3', 'nuxt3.js', 'npm-publish']",en,publish next appcomponents num usable normal vue without next usual way publishing vue component based video next workflow way easier almost nothing much configure num publish install package nextjsvuejsnextjsppublish along asked oct
929"how to scrape multiple pages with puppeteer i'm trying to scrape prices from multiple pages using puppeteer. what i'm having trouble with, is to write a single json file with all the scraped data. the problem is that if i try to write the file ... javascriptnode.jspromisepuppeteerfs fadrick 69 asked jun 28, 2022 at 13:40","['javascript', 'node.js', 'promise', 'puppeteer', 'fs']",en,scrape multiple pages puppeteer trying scrape prices multiple pages using puppeteer trouble write single son file scraped data problem try write file javascriptnodejspromisepuppeteerfs fabric asked jun
930"merge two json/javascript arrays in to one array i have two json arrays like var json1 = [{id:1, name: 'xxx' ...}] var json2 = [{id:2, name: 'xyz' ...}] i want them merge in to single arrays var finalobj = [{id:1, name: 'xxx' ...},{id:2, name: '... javascriptjqueryjson murtaza khursheed hussain 15.3k asked apr 30, 2012 at 13:52","['javascript', 'jquery', 'json']",en,merge two sonjavascript arrays one array two son arrays like var son id name xxx var son id name xyz want merge single arrays var finalobj id name xxx id name javascriptjqueryjson murtaza khursheed hussain k asked apr
931"certbot unable to locate environment variable credentials i have an ubuntu 20.04 server on an aws ec2 instance running apache and i'm trying to obtain a certificate using certbot, however i'm having trouble with credentials. below is the command i run, ... amazon-web-servicesapacheubuntulets-encryptcertbot tom 373 asked jun 20, 2020 at 21:42","['amazon-web-services', 'apache', 'ubuntu', 'lets-encrypt', 'certbot']",en,certbot unable locate environment variable credentials ubuntu server aws ec instance running apache trying obtain certificate using certbot however trouble credentials command run amazonwebservicesapacheubuntuletsencryptcertbot tom asked jun
932"app store/testflight upload error: missing dsym files for razorpay and hermes, and invalid executable due to bitcode [closed] i'm facing issues while uploading an ios build for a react native app (using hermes and razorpay) to app center and testflight. even after cleaning and rebuilding multiple times, i encounter the ... javascriptreact-nativenode-modules anil patel 35 asked yesterday","['javascript', 'react-native', 'node-modules']",en,app storetestflight upload error missing sym files razorpay heroes invalid executable due bibcode closed facing issues uploading ios build react native app using heroes razorpay app center testflight even cleaning rebuilding multiple times encounter javascriptreactnativenamemodules ani patel asked yesterday
933"svg clippath not showing i'm trying to use an svg over a video as a clippath. i tried one svg, which is showing the intended result. however, the other doesn't. plus, is there a way to de-couple the video from the svg tag for ... htmlsvg user10033434 465 asked apr 16, 2024 at 20:03","['html', 'svg']",en,svg clippath showing trying use svg video clippath tried one svg showing intended result however plus way decouple video svg tag htmlsvg user asked apr
934"the background color of xcb window is black #include <unistd.h> /* pause() */ #include <xcb/xcb.h> int main () { /* open the connection to the x server */ xcb_connection_t *connection = xcb_connect (null, null); /*... backgroundxcb user2266738 1 asked feb 8, 2024 at 7:34","['background', 'xcb']",en,background color cb window black include pause include int main open connection x server cbconnectiont connection cbconnect null null backgroundxcb user asked feb
935"react useeffect - in component or in service? we have a hook (service) for our component, which have an init() and a shutdown() function (for some reason). the init() should be called at least once to initiate (starts a heart-beat operations), ... reactjsreact-hooksreact-lifecycle zoltan hernyak 1,251 asked jul 4, 2024 at 5:53","['reactjs', 'react-hooks', 'react-lifecycle']",en,react useeffect component service hook service component init shutdown function reason init called least initiate starts heartbeat operations reactjsreacthooksreactlifecycle sultan hernia asked jul
936"ef warning - if the configured precision and scale don't match the column type in the database, this will cause values to be silently truncated recently we've migrated one of our project from ado.net to entityframework 7. in the log file we've noticed multiple warnings like the following, the decimal property 'objectid' is part of a key on ... c#.netentity-framework-coreentity-framework-6 kurubaran 8,902 asked dec 20, 2022 at 10:39","['c#', '.net', 'entity-framework-core', 'entity-framework-6']",en,ef warning configured precision scale match column type database cause values silently truncated recently migrated one project adonet entityframework log file noticed multiple warnings like following decimal property objectid part key cnetentityframeworkcoreentityframework kurubaran asked dec
937"your connection is not private error for azurewebsites.net in specific ip address [closed] my azure website uses the default azurewebsties.net domain. suddenly a ""your connection is not private error"" appears when the site is open in my office network. however, the error doesn't ... azureazure-web-app-service yuqing zhang 771 asked 2 days ago","['azure', 'azure-web-app-service']",en,connection private error azurewebsitesnet specific ip address closed azure website uses default azurewebstiesnet domain suddenly connection private error appears site open office network however error azureazurewebappservice using zhang asked days ago
938"restoring animation where it left off when app resumes from background i have an endlessly looping cabasicanimation of a repeating image tile in my view: a = [cabasicanimation animationwithkeypath:@""position""]; a.timingfunction = [camediatimingfunction ... ioscore-animation palimondo 7,411 asked sep 27, 2011 at 11:46","['ios', 'core-animation']",en,restoring animation left app resumes background endlessly looping cabasicanimation repeating image tile view cabasicanimation animationwithkeypathposition atimingfunction camediatimingfunction scoreanimation palimondo asked sep
939"how to add and select color for nodes/tree view items in explorer view in my vscode extension i have added my own explorer view in my extension. here i added nodes/tree view items however i am not finding any way to customize and choose color my tree view items in explorer view. any idea how ... visual-studio-codevscode-extensions ajayg 67 asked nov 15, 2022 at 16:55","['visual-studio-code', 'vscode-extensions']",en,add select color nodestree view items explorer view uscode extension added explorer view extension added nodestree view items however finding way customize choose color tree view items explorer view idea visualstudiocodevscodeextensions away asked nov
940"work with excel in vb.net fails without reason below code is about to export to excel file. visual studio sends the error in the picture. what is wrong with this code? imports microsoft.office.interop.excel module module3 public sub ooo() ... excelvb.netexcel-2010export-to-excel sherlock_holmes 109 asked may 21, 2023 at 11:35","['excel', 'vb.net', 'excel-2010', 'export-to-excel']",en,work excel vbnet fails without reason code export excel file visual studio sends error picture wrong code imports microsoftofficeinteriorexcel module module public sub excelnetexcelexporttoexcel sherlockholmes asked may
941"how to capture output from docker build in powershell on windows 11 i am attempting to capture the output of docker build when executed from a powershell script on windows. if i pipe the output, say to tee-object, i get: failed to get console mode for stdout: the ... docker mikejansen 3,486 asked jun 8, 2022 at 19:19",['docker'],en,capture output decker build powershell windows attempting capture output decker build executed powershell script windows pipe output say teeobject get failed get console mode stout decker mikejansen asked jun
942"asp.net core mimal apis - addendpointfilter throws invalidoperationexception addendpointfilter throws exception shown below in .net 7 (7.0.102) at program start under debug. used ide microsoft visual studio professional 2022 (64-bit) - current version 17.6.3 system.... c#asp.net-coreminimal-apis beda 41 asked jul 25, 2023 at 13:01","['c#', 'asp.net-core', 'minimal-apis']",en,aspnet core final apps addendpointfilter throws invalidoperationexception addendpointfilter throws exception shown net program start debug used ide microsoft visual studio professional bit current version system caspnetcoreminimalapps beta asked jul
943"attributeerror: 'numpy.ndarray' object has no attribute 'torch' or 'matmul' i am having attribute errors with my code. i have numpy version '1.25.1', python 3.10 and torch 2.0.1. when using transform and target_transform, i was following this pytorch tutorial (https://pytorch.... pythonnumpypytorchtorchvision bluetail 1,299 asked jul 27, 2023 at 10:30","['python', 'numpy', 'pytorch', 'torchvision']",en,attributeerror numarray object attribute torch mammal attribute errors code num version python torch using transform targettransform following pwtorch tutorial pythonnumpypytorchtorchvision bluetail asked jul
944"how to fetch local express server which is in same directory of frontend project? this is my project structure - backend > node_modules > .env package-lock.json package.json server.js frontend > index.html style.css script.js server.js import dotenv from 'dotenv'; ... javascriptnode.jsexpressdeploymentbackend vishwas babar 45 asked dec 22, 2023 at 10:08","['javascript', 'node.js', 'express', 'deployment', 'backend']",en,fetch local express server directory frontend project project structure backend nodemodules env packagelockson packageson serverjs frontend indexhtml stylecss scriptjs serverjs import dozen dozen javascriptnodejsexpressdeploymentbackend visas baba asked dec
945"error: invalid adapter: asyncstorage, js engine: hermes i updated my expo version from 47 to 49 and i get this error after execution. error: invalid adapter: asyncstorage, js engine: hermes at node_modules\react-native\libraries\core\exceptionsmanager.js:... react-nativepouchdb adabounou 11 asked aug 25, 2023 at 11:53","['react-native', 'pouchdb']",en,error invalid adapter asyncstorage js engine heroes updated expo version get error execution error invalid adapter asyncstorage js engine heroes nodemodulesreactnativelibrariescoreexceptionsmanagerjs reactnativepouchdb adabounou asked aug
946"fetching next.js api route returns 404 (not found) error (serverless and api ?) i am trying to fetch a next.js api route in my application, but i am encountering a 404 (not found) error. my folder structure is as follows: src/ views/ pages/ wizard/ checkout/ ... typescriptmongodbnext.jsserverless xif 343 asked may 4, 2023 at 19:17","['typescript', 'mongodb', 'next.js', 'serverless']",en,etching nextjs api route returns found error serverless api trying fetch nextjs api route application encountering found error folder structure follows src views pages wizard checkout typescriptmongodbnextjsserverless asked may
947"spring security - avoiding in-web-container role binding removes flexibility if using spring security in-app authentication/authorization, i would like the flexibility i have when i use j2ee web.xml descriptor and in-web-container authentication/authorization. i am using ldap (... spring-bootspring-securityweb.xmluser-rolesopen-liberty pixel 10.6k asked nov 4, 2023 at 3:18","['spring-boot', 'spring-security', 'web.xml', 'user-roles', 'open-liberty']",en,spring security avoiding inwebcontainer role binding removes flexibility using spring security inapp authenticationauthorization would like flexibility use jee webxml descriptor inwebcontainer authenticationauthorization using lap springbootspringsecuritywebxmluserrolesopenliberty pixel k asked nov
948"how to transfer userid from middleware to current controller? i would like to know what is the best practice to transfer userid from middleware to current executing controller ? for example i send request with bearer token to the controller as below: [route(&... c#asp.net-coremiddleware guinea pig taco 47 asked jan 11, 2024 at 17:45","['c#', 'asp.net-core', 'middleware']",en,transfer userid middleware current controller would like know best practice transfer userid middleware current executing controller example send request bearer token controller route caspnetcoremiddleware guinea pig tico asked jan
949"while re-assigning a static variable value in c#, it errors out - collection was modified; enumeration operation may not execute [duplicate] note: this is a typical scenario and please don't downvote this as duplicate because it is not. please read on and you will find out. the so called duplicate questions are at least 16 years old and ... c#multithreading.net-4.8 blogs4t 2,741 asked apr 21 at 13:37","['c#', 'multithreading', '.net-4.8']",en,reassigning static variable value c errors collection modified enumeration operation may execute duplicate note typical scenario please downvote duplicate please read find called duplicate questions least years old cmultithreadingnet blogst asked apr
950"waiter imagescancomplete failed: ecr image scan failing hope you are all doing well! i am running into an issue in my jenkins pipeline when i try to use the aws ecr wait image-scan-complete command. this is my jenkins pipeline code: pipeline { agent ... jenkinsjenkins-pipelinecicdamazon-ecr tt1997 221 asked mar 13, 2023 at 4:53","['jenkins', 'jenkins-pipeline', 'cicd', 'amazon-ecr']",en,waiter imagescancomplete failed er image scan failing hope well running issue jenkins pipeline try use aws er wait imagescancomplete command jenkins pipeline code pipeline agent jenkinsjenkinspipelinecicdamazoner tt asked mar
951"in rust, how can i unittest a struct in isolation from any structs it depends on? i'm still fairly new to rust and coming from almost exclusively python development. i've been trying to find a solution to this problem for a while now, but i'm also considering that i am approaching ... unit-testingruststruct benedikt 11 asked jun 28, 2024 at 16:44","['unit-testing', 'rust', 'struct']",en,rust unites struct isolation struct depends still fairly new rust coming almost exclusively python development trying find solution problem also considering approaching unittestingruststruct benedict asked jun
952"spring boot pod not coming up in kubernetes i have deployed my app in aws kubernetes cluster few days back and it has been a successful deploy and the app was up and running. recently we have changed the db password. now there are 4 apps which ... amazon-web-servicesspring-bootkubernetes som 1,610 asked jul 20, 2023 at 12:05","['amazon-web-services', 'spring-boot', 'kubernetes']",en,spring boot pod coming kubernetes deployed app aws kubernetes cluster days back successful deploy app running recently changed db password apps amazonwebservicesspringbootkubernetes som asked jul
953flutter amplify-authenticator-2.3.3 throws stateerror (bad state: no element) the code below seems faulty since it does not check if _authblock.exceptions.first exists. is there a way to avoid this issue? i have tried to rollback to version 2.0.0 but the error is still there. ... flutteraws-amplify oscar montoya 325 asked apr 20 at 6:07,"['flutter', 'aws-amplify']",en,clutter amplifyauthentication throws stateerror bad state element code seems faulty since check authblockexceptionsfirst exists way avoid issue tried rollback version error still flutterawsamplify oscar montana asked apr
954"nextjs api directory and usestate i am trying to get const [data, setdata] = react.usestate(''); const [pointdata, setpointdata] = react.usestate(''); in my api directory. however, everytime i try and run the code i get cannot read ... reactjsjsonformsnext.js russell harrower 845 asked may 28, 2022 at 8:17","['reactjs', 'json', 'forms', 'next.js']",en,next api directory estate trying get const data netdata reactestate const pointdata setpointdata reactestate api directory however overtime try run code get cannot read reactjsjsonformsnextjs russell narrower asked may
955"emotion/react issue with third party package i will first copy and paste my vite.config.ts file and package.json file in my component being pushed to npm and installed along with the package.json of the project installing the package: vite.... reactjstypescriptmaterial-uidependenciesvite lafarmer 39 asked apr 20, 2023 at 16:30","['reactjs', 'typescript', 'material-ui', 'dependencies', 'vite']",en,emotionreact issue third party package first copy paste siteconfigts file packageson file component pushed num installed along packageson project installing package site reactjstypescriptmaterialuidependenciesvite farmer asked apr
956"html table multi layer colspan i understood that this might have been answered before but i am unable to wrap my head around how to create a multi layered colspan in html table i have this html table from w3schools, however i want ... htmlhtml-table noob 279 asked feb 16, 2024 at 8:34","['html', 'html-table']",en,html table multi layer colspan understood might answered unable wrap head around create multi layered colspan html table html table wschools however want htmlhtmltable noon asked feb
957"vba rest api - dhl return label - 401 i am trying to create a return shipping dhl parcel label with provided dhl api in the sandbox: https://developer.dhl.com/api-reference/parcel-de-returns-post-parcel-germany#get-started-section/user-... vbarestdhl alex 1 asked feb 14, 2023 at 7:39","['vba', 'rest', 'dhl']",en,via rest api del return label trying create return shipping del parcel label provided del api sandbox vbarestdhl alex asked feb
958"microdata vs rdfa i have a quick question about rdfa and microdata. my current understanding is that rdfa is rdf implemented into html but is complicated for new developers like myself, microdata seems really easy and ... htmlsemantic-webmicrodatardfa user1043646 asked jan 22, 2012 at 0:11","['html', 'semantic-web', 'microdata', 'rdfa']",en,microdata vs rfa quick question rfa microdata current understanding rfa rdf implemented html complicated new developers like microdata seems really easy htmlsemanticwebmicrodatardfa user asked jan
959"how to link cuda dynamic libraries using cmake? i want to know how to use cmake to dynamically link cuda libraries, i know it seems to require some extra restrictions, but don't know exactly how to do it. here is a simple example i wrote to ... c++cmakecuda wang lei 3 asked jan 19, 2023 at 7:03","['c++', 'cmake', 'cuda']",en,link cuba dynamic libraries using make want know use make dynamically link cuba libraries know seems require extra restrictions know exactly simple example wrote ccmakecuda wang lei asked jan
960"reviewers cannot always approve merge requests in gitlab [closed] this is a technical question but also a legal one. in gitlab community edition, a reviewer is only a participant unless they have write permissions on the corresponding repository. as a consequence ... gitlab patrick fromberg 1,429 asked yesterday",['gitlab'],en,reviewers cannot always approve merge requests github closed technical question also legal one github community edition reviewer participant unless write permissions corresponding repository consequence github patrick fromberg asked yesterday
961"incorrect syntax near 'offset'. invalid usage of the option next in the fetch statement ""in entity framework core"" here's my code: var result = dbcontext.specialty.orderbydescending(u => u.ids) .skip(20) .take(10) .asenumerable(); error: incorrect syntax near 'offset'. ... c#asp.netsql-server-2008asp.net-coreentity-framework-core alireza 505 asked nov 17, 2018 at 7:17","['c#', 'asp.net', 'sql-server-2008', 'asp.net-core', 'entity-framework-core']",en,incorrect syntax near offset invalid usage option next fetch statement entity framework core code var result contextspecialtyorderbydescendingyou youids skip take asenumerable error incorrect syntax near offset caspnetsserveraspnetcoreentityframeworkcore alireza asked nov
962"eas build error when reaching ""install dependencies"" i've started using react native with expo not long ago so i am a bit lost. when trying to build the application with the command: eas build --profile development --platform android the build fails ... firebasereact-nativeexpoeas sapir 43 asked nov 26, 2022 at 20:51","['firebase', 'react-native', 'expo', 'eas']",en,eas build error reaching install dependencies started using react native expo long ago bit lost trying build application command eas build profile development platform android build fails firebasereactnativeexpoeas said asked nov
963"laravel: undefined method ""cannot"" what's weird about this is that the feature itself works perfectly fine, so i'm guessing it might be an issue with my intelephense but i have no idea how to fix or at least ignore the error message(in ... phplaravelneovimlanguage-server-protocol win barua 131 asked jun 10, 2023 at 21:01","['php', 'laravel', 'neovim', 'language-server-protocol']",en,travel undefined method cannot weird feature works perfectly fine guessing might issue intelephense idea fix least ignore error messagein phplaravelneovimlanguageserverprotocol win barra asked jun
964"how to use react native reanimated with eas builds? i have created an identical app twice, following the installations intstructions of the react-native-reanimated documentation https://docs.swmansion.com/react-native-reanimated/docs/fundamentals/... react-nativeexporeact-native-reanimatedeasreact-native-pdf kelbig 121 asked sep 16, 2023 at 17:05","['react-native', 'expo', 'react-native-reanimated', 'eas', 'react-native-pdf']",en,use react native animated eas builds created identical app twice following installations instructions reactnativeanimated documentation reactnativeexporeactnativereanimatedeasreactnativepdf selig asked sep
965"power automate expression to select value from json array when creating new row in spreadsheet table context: in my flow i have a for each loop to loop through a json array. the output of each loop is another json array, which i want to use to to add a new row to a spreadsheet (the first action in ... arraysjsonpower-automate steve 99 asked yesterday","['arrays', 'json', 'power-automate']",en,power automate expression select value son array creating new row spreadsheet table context flow loop loop son array output loop another son array want use add new row spreadsheet first action arraysjsonpowerautomate steve asked yesterday
966"the cache, users, jobs and personal_access_tokens tables are not created in laravel's public folder when creating a postgres database, the following tables are not automatically created: enter image description here as i understood they should be created in the 'public' folder, but it is empty. i ... phplaravelpostgresqldocker-compose blackout 1 asked 6 hours ago","['php', 'laravel', 'postgresql', 'docker-compose']",en,cache users jobs personalaccesstokens tables created travels public folder creating posters database following tables automatically created enter image description understood created public folder empty phplaravelpostgresqldockercompose blackout asked hours ago
967"how to vertically and horizontally center a text within a container in flutter i want to vertically and horizontally center a text within a white container in flutter. code i used to generate the following example but it is not vertically centered. any idea how to? return center(... flutter mkapp 547 asked jan 29, 2024 at 11:13",['flutter'],en,vertically horizontally center text within container clutter want vertically horizontally center text within white container clutter code used generate following example vertically centered idea return center clutter map asked jan
968how to restrict python overload to not being a literal is it possible in python typing to restrict a function argument to be not a literal? my usecase is the following. i have code like this example. class test(enum): a = 'a' b = 'b' @overload ... pythonpython-typingmypy loewexy 31 asked 2 days ago,"['python', 'python-typing', 'mypy']",en,restrict python overload literal possible python typing restrict function argument literal usecase following code like example class testnum b b overload pythonpythontypingmypy loewexy asked days ago
969"next-auth: login function redirects to /api/auth/error i'm having a problem where nextauth always returns to the error page it should return a user as per my code below: ./app/account/login/page.tsx ""use client""; import react, { usestate } ... javascriptreactjsnext.jsnext-auth luan tran 414 asked jun 26, 2023 at 14:10","['javascript', 'reactjs', 'next.js', 'next-auth']",en,nextauth login function redirects apiautherror problem nextauth always returns error page return user per code appaccountloginpagetax use client import react estate javascriptreactjsnextnextauth loan tran asked jun
970"unable to launch browser using selenium on docker. getting org.openqa.selenium.sessionnotcreatedexception i am trying to fetch title of the website ""https://www.google.com/"" in chrome browser using selenium on docker. however whenever i execute i get the following exception exception in thread &... javadockerselenium-webdriverautomation-testing pankaj yadav 13 asked jul 29, 2023 at 15:34","['java', 'docker', 'selenium-webdriver', 'automation-testing']",en,unable launch browser using selenium decker getting orgopenseleniumsessionnotcreatedexception trying fetch title website chrome browser using selenium decker however whenever execute get following exception exception thread javadockerseleniumwebdriverautomationtesting lanka yadav asked jul
971"update state in swiftui programatically i'm new to swift and coming from react i'm sure i'm thinking about state wrong. i have a view that has a simple text input. based on external events i'd like to update the contents of this field to ... swiftswiftuistatetextfield ryan 440 asked nov 16, 2023 at 6:19","['swift', 'swiftui', 'state', 'textfield']",en,update state swift programatically new swift coming react sure thinking state wrong view simple text input based external events would like update contents field swiftswiftuistatetextfield ryan asked nov
972"how can i create a floating div which expands to the edges? [closed] i want to create a navbar something like this: the name on the top left, and the div just to the right of that which expands to the right edge like it does normally if it wasn't floating. here's a ... htmlcss user24376710 23 asked apr 16, 2024 at 3:30","['html', 'css']",en,create floating div expands edges closed want create navbar something like name top left div right expands right edge like normally floating htmlcss user asked apr
973"host web api inside console app with .net 6 my question most likely will look like a bit trivial but i'm stuck... there is a lot of info about how to configure hosting web api in a console app, but it's not what i'm looking for. i'm in process ... .netasp.net-core.net-6.0 a. wheatman 6,396 asked mar 16, 2023 at 20:02","['.net', 'asp.net-core', '.net-6.0']",en,host web api inside console app net question likely look like bit trivial stuck lot info configure hosting web api console app looking process netsnetcorenet wheatman asked mar
974"strange uiview-encapsulated-layout-height error i'm making test application, so in my tableviewcell in storyboard i have imageview & webview (webview to show html-text). i set constraints like top/left/right/height=200 for imageview, spacing=... iosobjective-cuitableviewwebviewconstraints zaporozhchenko oleksandr 4,988 asked feb 9, 2015 at 12:54","['ios', 'objective-c', 'uitableview', 'webview', 'constraints']",en,strange reviewencapsulatedlayoutheight error making test application tableviewcell storyboard pageview review review show htmltext set constraints like topleftrightheight pageview spacing iosobjectivecuitableviewwebviewconstraints zaporozhchenko aleksandr asked feb
975"powershell not converting properly to csv? for some reason dates will always be my nemesis and i got a fairly simple issue but can't figure it out. and i know, this issue is one of the most described issues but even with the help of several ... excelpowershellcsvdatetime aad dijksman 45 asked oct 6, 2023 at 12:19","['excel', 'powershell', 'csv', 'date', 'time']",en,powershell converting properly csv reason dates always nemesis got fairly simple issue cannot figure know issue one described issues even help several excelpowershellcsvdatetime aad dijksman asked oct
976"react antd v4 autocomplete shows selected value instead of label upon selecting an option i am using react antd v3 & upgrading it to v4, i noticed one issue, where the autocomplete component was changed & now it is behaving in a weird manner passing a json array of [{value: string,... reactjsantd ahmed elkoussy 8,598 asked mar 4, 2020 at 16:37","['reactjs', 'antd']",en,react v autocomplete shows selected value instead label upon selecting option using react v upgrading v noticed one issue autocomplete component changed behaving weird manner passing son array value string reactjsantd ahmed elkoussy asked mar
977"axios error unable to verify leaf signature i applied to use a dictionary api and it was asked the url which i would be using it, i choosed locahost:19006, because it's where the local server is opening. and i have the api key, but for some ... reactjsaxios josé carlos 774 asked jun 23, 2022 at 1:16","['reactjs', 'axios']",en,axis error unable verify leaf signature applied use dictionary api asked url would using choose locahost local server opening api key reactjsaxios jose carlos asked jun
978"how to structure large data in firestore for multiple instances of reactflow data i am trying to determine the best way to structure data in firestore across multiple different reactflow flow charts. the amount of nodes and edges could grow to become large (could be up to 10,000 or ... google-cloud-firestoredatabase-designnosqlreact-flow jack hickson 3 asked apr 22, 2024 at 1:28","['google-cloud-firestore', 'database-design', 'nosql', 'react-flow']",en,structure large data restore multiple instances reactflow data trying determine best way structure data restore across multiple different reactflow flow charts amount nodes edges could grow become large could googlecloudfirestoredatabasedesignnosqlreactflow jack jackson asked apr
979"my srec file don't have line s0(content line) i use armclang and armlink to build my project and generate srec file but i have a issue, my srec file no have line content s0, it like: expect as when i use ghs my srec file will like: i don't find ... armarmclang hungcuiga1 118 asked jan 27, 2024 at 17:01","['arm', 'armclang']",en,sec file line scontent line use armclang arming build project generate sec file issue sec file line content like expect use gas sec file like find armarmclang hungcuiga asked jan
980"change multiple value of pandas column in a loop and update parent dataframe i have: df = pd.dataframe({'col1':[1,1,1,1,2,2,2], 'col2':['stuff' for i in range(7)]}) i want to subset the dataframe on col1, perform some stuff, and update the value of col1 for c in list(set(df.... pandasdataframe frank 3,656 asked feb 13, 2024 at 14:48","['pandas', 'dataframe']",en,change multiple value panda column loop update parent dataframe df pddataframecol colstuff range want subset dataframe col perform stuff update value col c listsetdf pandasdataframe frank asked feb
981"pil rotate image colors (bgr -> rgb) i have an image where the colors are bgr. how can i transform my pil image to swap the b and r elements of each pixel in an efficient manner? pythoncolorspython-imaging-library claudiu 230k asked jan 11, 2011 at 19:06","['python', 'colors', 'python-imaging-library']",en,pil rotate image colors bgr rgb image colors bgr transform pil image swap b r elements pixel efficient manner pythoncolorspythonimaginglibrary claudia k asked jan
982"the point the user is looking at becomes transparent when the screen is shared in visionos when you share an applevisionpro screen, a control button appears. this button follows your gaze and if you point your gaze somewhere, that place becomes semi-transparent is there any way to disable ... swiftswiftuirealitykitvisionos pogos anesyan 140 asked aug 29, 2024 at 9:01","['swift', 'swiftui', 'realitykit', 'visionos']",en,point user looking becomes transparent screen shared visions share applevisionpro screen control button appears button follows gaze point gaze somewhere place becomes semitransparent way disable swiftswiftuirealitykitvisionos logos anesyan asked aug
983"panic: gob: type elliptic.p256curve has no exported fields i am trying to build a blockchain project when i'm catching an issue about gob serialize. i have a struct wallet which uses elliptic.p256() curve struct, and when i'm trying to serialize wallet, a bug ... goelliptic-curvegob vango lu 31 asked sep 18, 2022 at 12:09","['go', 'elliptic-curve', 'gob']",en,panic go type ellipticpcurve exported fields trying build blockchain project catching issue go serialized struct wallet uses ellipticp curve struct trying serialized wallet bug ellipticcurvegob tango lu asked sep
984"plotly dash - issue with multi buttons callback trigger @app.callback( [output('page-content', 'children'), output('dashboard-selection-modal', 'is_open', allow_duplicate=true), output('dashboard-buttons', 'children')], [input('url', '... pythonplotly-dash daniel 101 asked may 29, 2024 at 18:26","['python', 'plotly-dash']",en,plot dash issue multi buttons rollback trigger approllback outputpagecontent children outputdashboardselectionmodal isopen allowduplicatetrue outputdashboardbuttons children inputurl pythonplotlydash daniel asked may
985"why does this error show up accessing the rtf of a richtextbox? i have a number of rich text boxes on my application that print data received from a digital modem type device. at times it is necessary to copy a window to another window because some of the text in ... vb.netwinformsrichtextbox rick ellison 27 asked nov 6, 2023 at 21:50","['vb.net', 'winforms', 'richtextbox']",en,error show accessing rtf richtextbox number rich text boxes application print data received digital modem type device times necessary copy window another window text vbnetwinformsrichtextbox rick allison asked nov
986"function pointer on generic class delegate i need to get a functionpointerfordelegate to pass a native p/invoke, but the function resides in a generic class of type myclass when i try to create the pointer i get an error of system.... c#delegates totalzero 345 asked mar 19, 2024 at 2:28","['c#', 'delegates']",en,function pointer generic class delegate need get functionpointerfordelegate pass native pinvoke function resides generic class type class try create pointer get error system cdelegates totalzero asked mar
987"how to fix 'list' object has no attribute 'render' error when using yolo object detection i'm following an object detection tutorial using yolo and this piece of code always throws the same error however is copied correctly. anyone know why? tutorial: https://www.youtube.com/watch?v=... pythonmatplotlibpytorch oscar gratton 1 asked may 28, 2023 at 21:51","['python', 'matplotlib', 'pytorch']",en,fix list object attribute render error using solo object detection following object detection tutorial using solo piece code always throws error however copied correctly anyone know tutorial pythonmatplotlibpytorch oscar ration asked may
988"executing sql queries indefinitely [closed] i have a table representing the header of an object, along with other tables to store description values for the object. we do not know in advance all the data that we will need to collect, since it ... sqlfirebirdfirebird-3.0 bojan gavrilovic 163 asked yesterday","['sql', 'firebird', 'firebird-3.0']",en,executing sql queries indefinitely closed table representing header object along tables store description values object know advance data need collect since sqlfirebirdfirebird born gavrilovic asked yesterday
989"error: command 'gcc' failed with exit status 1 on centos i'm trying to install lxml package on centos using sudo pip install lxml and its throwing this error right at the end: error: error: command 'gcc' failed with exit status 1 -------------------------... pythonlinuxbashpipcentos simple-solution 4,299 asked nov 13, 2013 at 14:02","['python', 'linux', 'bash', 'pip', 'centos']",en,error command gcc failed exit status cents trying install xml package cents using judo pip install xml throwing error right end error error command gcc failed exit status pythonlinuxbashpipcentos simplesolution asked nov
990"how to construct a graph using a list of tuples in python in networkx? i am trying to make a graph from a list of tuples stored in a variable. i found g.add_edges_from(e) for making graph using list of tuples. but the problem is that this does not work and when i try to ... pythongraphnetworkx orca 505 asked jun 1, 2023 at 10:41","['python', 'graph', 'networkx']",en,construct graph using list rules python network trying make graph list rules stored variable found gaddedgesfrome making graph using list rules problem work try pythongraphnetworkx orca asked jun
991"excluding a table from a oracle role i have a role for human users through which they get access to all tables in main schema of oracle db for my application. i want to create another role where i exclude few tables and keep access to ... oracle-databaseroles lokesh 7,950 asked feb 23, 2024 at 12:35","['oracle-database', 'roles']",en,excluding table oracle role role human users get access tables main schema oracle db application want create another role exclude tables keep access oracledatabaseroles lowest asked feb
992"join column with embeddedid, spring i have following database relations. person_race and race are important in my question. i have a problem with creating relationship between race and person_race. what kind of join should i use? ... javaspringjoin ser 37 asked aug 2, 2023 at 21:04","['java', 'spring', 'join']",en,join column embedded spring following database relations personrace race important question problem creating relationship race personrace kind join use javaspringjoin ser asked aug
993"pact testing in spring boot | error in installing the au.com.dius.pact:consumer:4.6.1 in intellij i am trying to learn pact testing but i am having issue in installing au.com.dius.pact:consumer:4.6.1 in intellij. i am using gradle for the build. i am using this thing in the build.gradle file ... javaspring-bootintellij-ideapact subhojit-dey 41 asked jun 23, 2023 at 15:55","['java', 'spring-boot', 'intellij-idea', 'pact']",en,pact testing spring boot error installing aucomdiuspactconsumer intellij trying learn pact testing issue installing aucomdiuspactconsumer intellij using grade build using thing buildgrade file javaspringbootintellijideapact subhojitdey asked jun
994"tkinter scrollbar on treeview table disappears when resized i wrote a table class using treeview: class simpledatatable(tk.frame): def __init__(self, parent, colheadings, colwidths, height): tk.frame.__init__(self, parent) self.parent = ... pythontkintertreeviewscrollbar nasif imtiaz ohi 1,731 asked apr 4, 2024 at 18:36","['python', 'tkinter', 'treeview', 'scrollbar']",en,painter scrollbar review table disappears resized wrote table class using review class simpledatatabletkframe def initself parent colheadings colwidth height tkframeinitself parent selfparent pythontkintertreeviewscrollbar basis imtiaz hi asked apr
995"getting error ""open failed: efault (bad address)"" when okhttp tries to send choosed from photopicker image this error occurs only when an image was choosed from photo picker on android 13 (on versions without photo picker all works!). what does code: user picks image from photo picker. get image's uri and ... javaandroidkotlinokhttpphoto-picker yoko999 31 asked jul 6, 2023 at 8:52","['java', 'android', 'kotlin', 'okhttp', 'photo-picker']",en,getting error open failed default bad address http tries send choose photopicker image error occurs image choose photo picked android versions without photo picked works code user picks image photo picked get images uri javaandroidkotlinokhttpphotopicked yoke asked jul
996"opengl es sync, how to send the completed signal by the cpu? through the extension egl_khr_fence_sync, we can achieve multi-threaded gpu synchronization by using interfaces such as eglcreatesynckhr(), egldestroysynckhr(), and eglclientwaitsynckhr(); when the ... c++opengl-essynchronizationegl grady 1 asked 5 hours ago","['c++', 'opengl-es', 'synchronization', 'egl']",en,open es sync send completed signal cpu extension elhrfencesync achieve multithreaded gpu synchronization using interfaces eglcreatesynckhr egldestroysynckhr eglclientwaitsynckhr copenessynchronizationegl gray asked hours ago
997"when should i ever use file.read() or file.readlines()? i noticed that if i iterate over a file that i opened, it is much faster to iterate over it without reading it first. that is: l = open('file','r') for line in l: ... is much faster than l = open(... pythoniotimeit maverick meerkat 6,444 asked jun 29, 2016 at 16:39","['python', 'io', 'timeit']",en,ever use fileread fileheadlines noticed literate file opened much faster literate without reading first l openfiler line l much faster l open pythoniotimeit maverick meerkat asked jun
998"what is the ideal way to json.stringify in terraform? i'm working on my first terraform project and i'm looking for the best way to stringify a json object. the resource i'm defining has a parameter that expects a json string. json structure is: ""... jsonterraformhcl jeremy schultz 677 asked feb 9, 2023 at 14:44","['json', 'terraform', 'hcl']",en,ideal way sonstringify terraform working first terraform project looking best way stringify son object resource defining parameter expects son string son structure jsonterraformhcl jeremy schultz asked feb
999"phpoffice\phpspreadsheet\reader\xlsx getsheetbyname not working i hate posting this because i feel like this should be simple, but i have investigated and tested many things. my script has been working fine if i want the first sheet to be read. again, that works ... phpspreadsheetphpoffice-phpspreadsheet joey martin 409 asked jul 17, 2024 at 19:26","['phpspreadsheet', 'phpoffice-phpspreadsheet']",en,phpofficephpspreadsheetreaderxls getsheetbyname working hate posting feel like simple investigated tested many things script working fine want first sheet read works phpspreadsheetphpofficephpspreadsheet joey martin asked jul
1000"how to pass a variable to a slot in svelte? i'm just getting started with slots and would like to pass variables to the slot without using stores (e.g. colors, active state, etc), but i can't get it to work, despite having read the tutorial ... javascriptsveltesvelte-component markstar 873 asked apr 17, 2023 at 10:12","['javascript', 'svelte', 'svelte-component']",en,pass variable slot shelter getting started slots would like pass variables slot without using stores eg colors active state etc cannot get work despite read tutorial javascriptsveltesveltecomponent barnstar asked apr
1001"neo4j-admin database load throw java.lang.unsatisfiedlinkerror i was using neo4j aura db for a non-profit university project as now we have funidng for renting vm from our own university, we desired to migrate the data from neo4j aura to the vm in the same lan ... neo4j jerryishere 499 asked jun 1, 2023 at 3:35",['neo4j'],en,neojadmin database load throw javalangunsatisfiedlinkerror using neoj aura db nonprofit university project funding renting vm university desired migrate data neoj aura vm lan neoj jerryishere asked jun
1002"iptables block access to port 8000 except from ip address [closed] i've never used iptables, and the documentation online seems a bit opaque. i'd like to block all requests to port 8000 on my server except those coming from a specific ip address. how do i do that ... firewalliptables will 3,191 asked sep 14, 2011 at 21:38","['firewall', 'iptables']",en,tables block access port except ip address closed never used tables documentation online seems bit opaque would like block requests port server except coming specific ip address firewalliptables asked sep
1003"passing data to buildform() in symfony 2.8, 3.0 and above my application currently passes data to my form type using the constructor, as recommended in this answer. however the symfony 2.8 upgrade guide advises that passing a type instance to the createform ... phpsymfony jonathan 15.5k asked dec 1, 2015 at 18:41","['php', 'symfony']",en,passing data buildform symphony application currently passes data form type using constructor recommended answer however symphony upgrade guide advises passing type instance createform phpsymfony jonathan k asked dec
1004"binance timestamp error (timestamp for this request is outside of the recvwindow. m 1) i'm using binance broker api, when executing my code. i got this error : data: { code: -1021, msg: 'timestamp for this request is outside of the recvwindow.' } then i have used binance server ... unix-timestampbinance souleymane toure 43 asked sep 16, 2021 at 12:27","['unix-timestamp', 'binance']",en,finance timestamp error timestamp request outside recvwindow using finance broker api executing code got error data code message timestamp request outside recvwindow used finance server unixtimestampbinance souleymane tour asked sep
1005"client cert using postman and curl as part of mtls, we are required to provide client certificate to the server while making a rest connection. if i look at the curl request this is how the syntax looks curl -v --cert cert.crt --key ... curlpostmanmtls sqlprofiler 111 asked aug 30, 2023 at 8:16","['curl', 'postman', 'mtls']",en,client cert using postal curl part mls required provide client certificate server making rest connection look curl request syntax looks curl v cert certcrt key curlpostmanmtls sqlprofiler asked aug
1006"how to subtract sample data set from parent data set on base of index? how to get a train data set with 7 rows from a main data set of 10 rows after creating a test data set with 3 random rows, i need to subtract the test data set from the main data set. however, i need ... pythonpandasdataframesubtractiontrain-test-split ramaa overseas 1 asked apr 24, 2024 at 18:00","['python', 'pandas', 'dataframe', 'subtraction', 'train-test-split']",en,subtract sample data set parent data set base index get train data set rows main data set rows creating test data set random rows need subtract test data set main data set however need pythonpandasdataframesubtractiontraintestsplit rama overseas asked apr
1007"setting selectedindex = 0 in listbox causing context switch deadlock i have a winform with 2 sets of paired listboxes like so: listprovider -> listproviderlocations listassistant -> listassistantlocations the basic idea is the user can choose which locations they ... c#winforms william j. starck 93 asked feb 21, 2024 at 20:23","['c#', 'winforms']",en,setting selectedindex listbox causing context switch deadlock inform sets paired listboxes like listprovider listproviderlocations listassistant listassistantlocations basic idea user choose locations cinforms william j stack asked feb
1008"app password option missing for specific user in office 365 – how to enable? [closed] we are using office 365 with modern authentication and 2fa enabled. i need to access emails from one specific inbox using imap or pop3 in a backend cron job, and for that, i understand an app password ... azureoutlookmicrosoft-graph-apioffice365 salman bashir 1 asked 2 days ago","['azure', 'outlook', 'microsoft-graph-api', 'office365']",en,app password option missing specific user office enable closed using office modern authentication fa enabled need access emails one specific index using map pop backend con job understand app password azureoutlookmicrosoftgraphapioffice salman baseip asked days ago
1009"responsive image source (sizes) based on parent (wrapper) width given the following code snippet, my goal is to achieve that based on the parent width / wrapper, the image (source) changes accordingly.
<!doctype html> <html> <head> <... htmlcssimageresponsive francis 495 asked nov 3, 2023 at 11:52","['html', 'css', 'image', 'responsive']",en,responsive image source sizes based parent wrapper width given following code snippet goal achieve based parent width wrapper image source changes accordingly htmlcssimageresponsive francis asked nov
1010"telerik html5 reportviewer - how to set noheader fror csv export option i'm having issue to retrieve a nice/neat csv export from the html5 reportviewer. in other report methods, there are noheader, nostatictext parameters for csv export. those 2 can eliminate the column ... telerikreportviewer ph0ngvu 47 asked nov 15, 2024 at 12:04","['telerik', 'reportviewer']",en,telerik html reportviewer set header csv export option issue retrieve niceneat csv export html reportviewer report methods header nostatictext parameters csv export eliminate column telerikreportviewer phngu asked nov
1011"number of partitions in rdd and performance in spark in pyspark, i can create a rdd from a list and decide how many partitions to have: sc = sparkcontext() sc.parallelize(xrange(0, 10), 4) how does the number of partitions i decide to partition my rdd ... performanceapache-sparkpysparkrdd martina.physics 9,814 asked mar 4, 2016 at 16:13","['performance', 'apache-spark', 'pyspark', 'rdd']",en,number partitions red performance spark spark create red list decide many partitions sc sparkcontext scparallelciterange number partitions decide partition red performanceapachesparkpysparkrdd martinphysics asked mar
1012"invalid _type: undefined in loadqachain in typescript langchain i am trying to use loadqachain with a custom prompt. the code to make the chain looks like this: import { openai } from 'langchain/llms/openai'; import { pineconestore } from 'langchain/vectorstores/... typescriptnext.jsopenai-apilangchain csrf_akkademi 21 asked jun 19, 2023 at 21:59","['typescript', 'next.js', 'openai-api', 'langchain']",en,invalid type undefined loadqachain typescript langchain trying use loadqachain custom prompt code make chain looks like import open langchainlnmsopen import pineconestore langchainvectorstores typescriptnextjsopenaiapilangchain csrakademi asked jun
1013"long / short press a key? i would like to do this : if ctrl was pressed down for more than 200ms (long press) it doesn't anything if the key was pressed down for less than 200ms (short press), send(""a"") i got these : ... scriptingautohotkey yfjuu 0 19 asked dec 16, 2023 at 18:47","['scripting', 'autohotkey']",en,long short press key would like ctrl pressed ms long press anything key pressed less ms short press senda got scriptingautohotkey yfjuu asked dec
1014"encoding newlines in ical files i'm trying to figure out how to encode newlines in the description part of an ical file in such a way that they will import properly into outlook, google calendar and the apple calendar. the original ... icalendar eric petroelje 60.6k asked mar 20, 2009 at 16:30",['icalendar'],en,encoding declines cal files trying figure encode declines description part cal file way import properly outlook google calendar apple calendar original calendar eric petroelje k asked mar
1015"raw_input without pressing enter i'm using raw_input in python to interact with user in shell. c = raw_input('press s or n to continue:') if c.upper() == 's': print 'yes' it works as intended, but the user has to press enter in ... pythonuser-input somebody still uses you ms-dos 13.4k asked aug 19, 2010 at 15:07","['python', 'user-input']",en,rawinput without pressing enter using rawinput python interact user c rawinputpress n continue cupper print yes works intended user press enter pythonuserinput somebody still uses msdos k asked aug
1016"i am unable to use canvas from @react-three/fiber here is the error that i am getting could not resolve ""three"" node_modules/three-mesh-bvh/src/core/castfunctions.js:1:39: 1 │ import { box3, vector3, matrix4 } from 'three'; ╵ ... reactjsvitereact-three-fiberreact-three-drei purav kapoor 11 asked mar 19, 2023 at 12:25","['reactjs', 'vite', 'react-three-fiber', 'react-three-drei']",en,unable use canvas reactthreefiber error getting could resolve three nodemodulesthreemeshbhsrccorecastfunctionsjs import box vector matrix three reactjsvitereactthreefiberreactthreedrei prev kapoor asked mar
1017"merging multiple spatrasters by sum in r package terra i have two spatrasters that i want to merge. when they merge i want each pixel to sum the values from both rasters. i have tried the following code but it does not work. how can i do this? ... rmergespatialr-rasterterra james jr 21 asked mar 29, 2023 at 15:45","['r', 'merge', 'spatial', 'r-raster', 'terra']",en,merging multiple spatrasters sum r package terra two spatrasters want merge merge want pixel sum values masters tried following code work rmergespatialrrasterterra james jr asked mar
1018"trying to use 'ref' in typescript schema models giving error without property '' does not exist on type 'objectid' error below is part of my code . i am coming from js to typescript. trying to convert my existing js code to typescript. i can't seem to figure out this error . error property 'uniqueaddress' does not exist ... typescriptmongoosetypescript-typingsmongoose-populate fist ace 47 asked oct 4, 2023 at 6:29","['typescript', 'mongoose', 'typescript-typings', 'mongoose-populate']",en,trying use ref typescript schema models giving error without property exist type objectid error part code coming js typescript trying convert existing js code typescript cannot seem figure error error property uniqueaddress exist typescriptmongoosetypescripttypingsmongoosepopulate fist ace asked oct
1019"error deploying in vercel (typeerror: cannot read properties of undefined (reading 'and')) i met this error while deploying on vercel. npm run build showed no error config : ""node"": ""18"", ""next"": ""^14.0.0"", ""next-transpile-modules"": ""^9.... javascriptnext.jsbuildvercelgsap rom-888 886 asked oct 27, 2023 at 16:16","['javascript', 'next.js', 'build', 'vercel', 'gsap']",en,error deploying vessel typeerror cannot read properties undefined reading met error deploying vessel num run build showed error config node next nexttranspiredmodules javascriptnextjsbuildvercelgsap rom asked oct
1020"cant write value an input element in .md file content on angular in angular, i am retrieving the content of a .md file from the backend. this .md content includes input tags like . i can add these inputs to a previously created form, but i am unable to enter data ... node.jsangulartypescriptmarkdown ömer faruk şan 1 asked jun 10, 2024 at 13:34","['node.js', 'angular', 'typescript', 'markdown']",en,cannot write value input element md file content angular angular retrieving content md file backend md content includes input tags like add inputs previously created form unable enter data nodejsangulartypescriptmarkdown omer far san asked jun
1021"terraform aws_ssm_parameter overwrite alternative since the 'overwrite' attribute is deprecated as of terraform version 5 (https://registry.terraform.io/providers/hashicorp/aws/latest/docs/guides/version-5-upgrade#resourceaws_ssm_parameter), i have a ... terraform yonatan voi 11 asked jul 20, 2023 at 9:13",['terraform'],en,terraform awsssmparameter override alternative since override attribute deprecated terraform version terraform jonathan voi asked jul
1022"how to print nested json data using python? i just started programming. i'm trying to print some nested json data using a python script. here's an example of the json: { ""objects"": [ { ""id"": ""1"",... pythonjsonpython-requestsnested dragon 3 asked sep 27, 2023 at 8:33","['python', 'json', 'python-requests', 'nested']",en,print nested son data using python started programming trying print nested son data using python script example son objects id pythonjsonpythonrequestsnested dragon asked sep
1023"laravel jwt auth only returns true/false if i set auth.php like this -->> 'defaults' => [ 'guard' => 'web', 'passwords' => 'users', ], login maintains if i go mainpage , and return token is only true/... laraveljwt zzxczxczaa 185 asked jan 23, 2022 at 8:25","['laravel', 'jwt']",en,travel jet auth returns truefalse set authphp like defaults guard web passwords users login maintains go mainpage return token true laraveljwt zzxczxczaa asked jan
1024"no output file after running slurm dmtcp job after running a slurm job, i can't find the output file anywhere. the squeue command shows that the job is executing correctly, and there aren't any error logs on the current directory, from which i ... slurmsbatch raphael santos 29 asked mar 26, 2024 at 14:52","['slurm', 'sbatch']",en,output file running slur ditch job running slur job cannot find output file anywhere queue command shows job executing correctly error logs current directory slurmsbatch raphael santos asked mar
1025"optimization with a nested set of constraints i am trying to use gekko to find an optimal solution for a camera lens distortion calibration problem (undistort). in my case i am interested in solving a simpler problem that is only concerned with ... pythongekko sassycat 53 asked jan 17, 2024 at 17:59","['python', 'gekko']",en,optimization nested set constraints trying use gecko find optimal solution camera lens distortion calibration problem distort case interested solving simpler problem concerned pythongekko sassycat asked jan
1026"microsoft teams web-hook return respond 404 for adaptive card i was trying to send data to microsoft teams with a valid webhook my code is below import requests import json url = ""https://webhooks.valid_url.com/webhookhandler/test"" payload = json.... pythonpython-3.xpython-requestsmicrosoft-teamsadaptive-cards antu 2,333 asked sep 26, 2023 at 7:01","['python', 'python-3.x', 'python-requests', 'microsoft-teams', 'adaptive-cards']",en,microsoft teams webhook return respond adaptive card trying send data microsoft teams valid ebook code import requests import son url payload son pythonpythonpythonrequestsmicrosoftteamsadaptivecards anti asked sep
1027"c# developers learning java, what are the biggest differences one may overlook? [closed] for c# developers that are staring out to learn java, are there any big underlying differences between the two languages that should be pointed out? maybe some people may assume things to be the same,... c#java mrblah 104k asked jan 6, 2010 at 17:07","['c#', 'java']",en,c developers learning java biggest differences one may overlook closed c developers staring learn java big underlying differences two languages pointed maybe people may assume things cjava blah k asked jan
1028documentextractionskill in azure cognitive search returns null for base64 data from sql source i'm encountering an issue with azure cognitive search where the documentextractionskill is returning null when processing base64 data from a sql data source. i've set up a skillset that uses a ... azureazure-cognitive-servicesazure-cognitive-search matvdl 63 asked apr 20 at 12:12,"['azure', 'azure-cognitive-services', 'azure-cognitive-search']",en,documentextractionskill azure cognitive search returns null base data sql source encountering issue azure cognitive search documentextractionskill returning null processing base data sql data source set skills uses azureazurecognitiveservicesazurecognitivesearch marvel asked apr
1029"what does `actix-web` use a provided `tokio` runtime for? the documentation for actix_web::httpserver::run() says this method starts a number of http workers in separate threads. [...] one worker set is created for each socket address to be bound. [...] ... rustactix-web dreamer 1,262 asked sep 20, 2023 at 10:00","['rust', 'actix-web']",en,actinweb use provided tokyo runtime documentation actinweb says method starts number http workers separate threads one worker set created socket address bound rustactixweb dreamer asked sep
1030"in octave, how to compile a mex file from multiple c/c++ source files? in matlab, we can use mex to compile a library from multiple files (e.g., 100+ .c files) using something like mex *.c -o mylib.mex but in octave, it seems like that only one input source file accepted,... matlaboctavemex zhaokg 391 asked jul 12, 2023 at 15:34","['matlab', 'octave', 'mex']",en,octave compile mex file multiple cc source files atlas use mex compile library multiple files eg c files using something like mex c mlbmex octave seems like one input source file accepted matlaboctavemex zhang asked jul
1031"errror 3554 while importing a .sql file error 3554 (hy000) at line 318: access to system table 'mysql.innodb_index_stats' is rejected. operation failed with exitcode 1 11:27:20 import of c:\users\veloxshop\downloads\dumpfilename.sql has ... mysqlmysql-workbench baitalon 321 asked nov 1, 2018 at 15:00","['mysql', 'mysql-workbench']",en,error importing sql file error hy line access system table myselfnndbindexstats rejected operation failed exitcode import cusersveloxshopdownloadsdumpfilenamesql mysqlmysqlworkbench battalion asked nov
1032"similarity score in between 2d arrays of different size these are 2d (z=0) poly lines in 3d application blender and they are used as paths. i would like to know the similarity score between them. it’s important to distinguish between the concepts of ... pythoncosine-similaritycross-correlation prashant 923 asked apr 17, 2024 at 11:20","['python', 'cosine-similarity', 'cross-correlation']",en,similarity score arrays different size z poly lines application blender used paths would like know similarity score important distinguish concepts pythoncosinesimilaritycrosscorrelation peasant asked apr
1033"error: failed to solve: process ""/bin/sh -c pip install pyqt5"" did not complete successfully: exit code: 1 i'm facing issues while trying to install pyqt5 in a docker container running on my m1 mac. i'm getting an ""exit code 1"" error, and i'm not sure how to resolve it. here are the details of ... pythondockerapple-m1arm64docker-build artemii khristich 67 asked sep 7, 2023 at 16:50","['python', 'docker', 'apple-m1', 'arm64', 'docker-build']",en,error failed solve process binsh c pip install part complete successfully exit code facing issues trying install part decker container running mac getting exit code error sure resolve details pythondockerapplemarmdeckerbuild artemii khristich asked sep
1034"is it recommended for a bounded context to communicate with another to validate entity relationships in domain-driven design (ddd)? i am developing an application using domain-driven design (ddd), and i have defined two bounded contexts: ""catalog"" and ""pricemanagement."" in the ""catalog"" bounded ... microservicesdomain-driven-designbounded-contexts julian gr 123 asked jul 31, 2023 at 19:13","['microservices', 'domain-driven-design', 'bounded-contexts']",en,recommended bounded context communicate another validate entity relationships domaindriven design ddd developing application using domaindriven design ddd defined two bounded contexts catalog pricemanagement catalog bounded microservicesdomaindrivendesignboundedcontexts julian gr asked jul
1035"how to do git commit using personal access token? i made all permission reserved personal access token on github. i saw that git clone https://<username>:<personal_access_token>@github.com/<username>/<project_name>.git works. ... git david foie gras 2,080 asked jun 3, 2020 at 15:52",['git'],en,git commit using personal access token made permission reserved personal access token github saw git clone works git david foil gras asked jun
1036put nested bash shell to background i can switch back and forth between commands in bash: $ vim ctrl-z # vim is in background now # can resume it with: $ fg i'm trying to do the same with a nested shell but it's not working: # launch ... bashshell user19315471 634 asked 16 hours ago,"['bash', 'shell']",en,put nested bash background switch back forth commands bash ctrlz background resume fg trying nested working launch bashshell user asked hours ago
1037"magnetometer heading calculation? i am using mpu9250 from adafruit (https://learn.adafruit.com/adafruit-tdk-invensense-icm-20948-9-dof-imu) this sensor is outputting raw data of magnetometer. i was able to calibrate data from to ... pythoncompassmagnetometer park bo 113 asked jul 4, 2023 at 18:48","['python', 'compass', 'magnetometer']",en,magnetometer heading calculation using mp adafruit sensor outputting raw data magnetometer able calibrated data pythoncompassmagnetometer park bo asked jul
1038"flutter: agora chat appkey is invalid error i am trying to create a chat app using flutter and the agora sdk. however, when i try to connect to the agora server, i am getting the following error message: ""error code 100, appkey is invalid&... flutteragora.io ahmed taher 11 asked jun 14, 2023 at 17:09","['flutter', 'agora.io']",en,clutter agora chat apply invalid error trying create chat app using clutter agora sdk however try connect agora server getting following error message error code apply invalid flutteragoraio ahmed taker asked jun
1039"installing scikit-surprise with anaconda i am trying to install scikit-surprise in my laptop using anaconda but i get this error during installation the following packages are causing the inconsistency: conda-forge/win-64::aws-c-auth==0.7.4=... windowsscikit-learnanaconda gustavo llanos 1 asked apr 27, 2024 at 20:43","['windows', 'scikit-learn', 'anaconda']",en,installing spiritsurprise anaconda trying install spiritsurprise laptop using anaconda get error installation following packages causing inconsistency hondaforgewinawscauth windowsscikitlearnanaconda gustavo plans asked apr
1040"pyjwt won't import jwt.algorithms (modulenotfounderror: no module named 'jwt.algorithms') for some reason, pyjtw doesn't seem to work on my virtualenv on ubuntu 16.04, but it worked fine on my local windows machine (inside a venv too). i'm clueless, i've tried different versions, copied ... pythonpython-3.xoauth-2.0 ferry 123 asked sep 29, 2020 at 22:04","['python', 'python-3.x', 'oauth-2.0']",en,pyjwt import jetalgorithms modulenotfounderror module named jetalgorithms reason ytw seem work virtualenv ubuntu worked fine local windows machine inside vent clueless tried different versions copied pythonpythonsouth ferry asked sep
1041"tkinter mousewheel scroll on multipe tabs i can't seem to get the mousewheel to scroll on a multiple tab tkinter. it only scrolls the first tab. tried a few different things but cannot seem to work it out. any help would be great :) basiclly ... pythontkintermousewheel chris 3 asked feb 3, 2024 at 13:00","['python', 'tkinter', 'mousewheel']",en,painter mousewheel scroll multiple tabs cannot seem get mousewheel scroll multiple tab painter scrolls first tab tried different things cannot seem work help would great basically pythontkintermousewheel chris asked feb
1042"sqlalchemy error in python 3.11 when trying to initialize a table; it used to work in python 3.8 running the code below. it used to run in version python 3.8. recently i upgraded to 3.11 and it stopped working. i upgraded both sqlalchemy and pyodbc. i have longer code but posting up to the first ... pythonsqlalchemy goodwin lion 21 asked may 1, 2023 at 14:11","['python', 'sqlalchemy']",en,sqlalchemy error python trying initiative table used work python running code used run version python recently upgraded stopped working upgraded sqlalchemy pyodbc longer code posting first pythonsqlalchemy goodwill lion asked may
1043"in pysimplegui, simplifying event loop by calling an event handler function i wanted to simplify the event loop by providing a function to call when the element would generate an event. this works because the 'key' of the elements can also be an object, in this case a newly ... pythonevent-handlingpysimplegui ernest ter kuile 41 asked feb 7, 2024 at 12:32","['python', 'event-handling', 'pysimplegui']",en,pysimplegui simplifying event loop calling event handler function wanted simplify event loop providing function call element would generate event works key elements also object case newly pythoneventhandlingpysimplegui ernest ter asked feb
1044"how to get details of group selection in streamlit-aggrid i am using streamlit extension streamlit-aggrid and i have a selectable table with row groups. i am not able to gather all details of the rows selected when selecting a grouped row. here is a runnable ... pythonag-gridstreamlit pietroppeter 1,483 asked feb 21, 2023 at 17:13","['python', 'ag-grid', 'streamlit']",en,get details group selection streamlinegrid using streamline extension streamlinegrid selectable table row groups able gather details rows selected selecting grouped row unable pythongridstreamlit pietroppeter asked feb
1045"what happens when rendering an opengl buffer that has been padded with null (or another value)? i have the following setup: s - the scene that includes terrain, some houses and other man-made objects t - a set of tree configurations that i would like to iterate through and place in s. every ... openglrenderingpaddingframebuffer rbaleksandar 9,751 asked mar 26, 2024 at 4:21","['opengl', 'rendering', 'padding', 'framebuffer']",en,happens rendering open buffer padded null another value following setup scene includes terrain houses manmade objects set tree configurations would like literate place every openglrenderingpaddingframebuffer rbaleksandar asked mar
1046"sh: 1: rimraf: not found whenever i run npm run build within vagrant installed on windows 10 or macos i want to run a webpack project within vagrant (installed on windows 10) where i embedded a ubuntu 16.04 virtual machine. i was able to install npm 5.6.0 and nodejs v8.9.4 very successfully. i ... node.jsnpmwebpackvagrantwindows-10 kabrice 1,655 asked mar 4, 2018 at 4:56","['node.js', 'npm', 'webpack', 'vagrant', 'windows-10']",en,sh rimraf found whenever run num run build within vagrant installed windows marcos want run webpage project within vagrant installed windows embedded ubuntu virtual machine able install num nodes v successfully nodejsnpmwebpackvagrantwindows fabric asked mar
1047"gradient descent residual i've implemented the gradient descent method for finding roots of a system of nonlinear equations and i am wondering how the residual is determined? is the residual simply the euclidean norm (2-norm) ... pythonnumerical-methodsgradient-descentconvergence blov 9 asked nov 17, 2023 at 8:52","['python', 'numerical-methods', 'gradient-descent', 'convergence']",en,gradient descent residual implemented gradient descent method finding roots system nonlinear equations wondering residual determined residual simply euclidean norm norm pythonnumericalmethodsgradientdescentconvergence blog asked nov
1048"how can i get a mongo facet to filter by regex in .net? i've been trying for quite some time to get this code to work. but it just doesn't, i don't understand why: public async task<paginateddata<dbuser>> getpaginatedasync( int pagesize, ... c#asp.net.netmongodbmongo-driver diegowrhasta 1 asked apr 30, 2024 at 2:25","['c#', 'asp.net', '.net', 'mongodb', 'mongo-driver']",en,get mono facet filter regex net trying quite time get code work understand public sync task getpaginatedasync int imagesize caspnetnetmongodbmongodriver diegowrhasta asked apr
1049"how to embed ""aveva (osi soft) - pi vision"" displays i am working on a website in which i want to integrate aveva (osi soft) pi vision. main requirement is to embed the pi vision displays in the new website. i have a user, by which i am able to login on ... authenticationcurlntlm-authenticationosisoft harish sharma 1,277 asked jul 11, 2023 at 12:59","['authentication', 'curl', 'ntlm-authentication', 'osisoft']",en,embed area osi soft pi vision displays working website want integrate area osi soft pi vision main requirement embed pi vision displays new website user able login authenticationcurlntlmauthenticationosisoft parish sharma asked jul
1050"react is not rendering .png photos on browser i'm working on a small workshop app, but i have trouble displaying the photos of the cars in the browser. i just get the placeholder on an image import react from ""react""; function ... reactjsdefault.png ahmed_cz 35 asked apr 27, 2024 at 17:11","['reactjs', 'default.png']",en,react rendering png photos browser working small workshop app trouble displaying photos cars browser get placeholder image import react react function reactjsdefaultpng ahmedcz asked apr
1051"how to storage data in server memory in nextjs 13 app directory i have a basic form in nextjs with some validations and when i click on the submit button i handle the event and i create a json with the retrieved data. right now i'm doing a console.log of the json ... server-side-renderingnext.js13 alex 83 asked sep 19, 2023 at 10:19","['server-side-rendering', 'next.js13']",en,storage data server memory next app directory basic form next validation click submit button handle event create son retrieved data right consolelog son serversiderenderingnextjs alex asked sep
1052"how to display datazoomselect as disabled but visible in echarts toolbox? i'm working with an echarts chart and i want to configure the datazoom option within the toolbox.feature to be visible but initially disabled. here is the configuration snippet i am using: toolbox = { ... javascriptecharts xavier patiño 143 asked jul 29, 2024 at 9:21","['javascript', 'echarts']",en,display datazoomselect disabled visible charts toolbox working charts chart want configure datazone option within toolboxfeature visible initially disabled configuration snippet using toolbox javascriptecharts xavier pathno asked jul
1053"what are the wcag color contrast requirements for a progress indicator? elements in question html progress element ios progress indicator android progress indicator) assumptions there is no additional textual information describing the progress indicator wcag ... accessibilityprogress-indicator common room 31 asked sep 14, 2023 at 17:54","['accessibility', 'progress-indicator']",en,wag color contrast requirements progress indicator elements question html progress element ios progress indicator android progress indicator assumptions additional textual information describing progress indicator wag accessibilityprogressindicator common room asked sep
1054"tkinter widget doesnt move i have a widget which if i stand at coords lets say 100 and he is at coords 200 he is supposed to move to 100 he is supposed to follow me i did print his coords like u can see in the code and its the ... pythontkintertkinter-canvas coder34321553667 1 asked mar 22, 2024 at 10:11","['python', 'tkinter', 'tkinter-canvas']",en,painter widget move widget stand coords let us say coords supposed move supposed follow print coords like see code pythontkintertkintercanvas coder asked mar
1055"images will not load after a certain page in vite react project i am building an e-commerce website, the problem is that after a certain page, images do not load anymore and i always get the alt text data. it is not an issue with the image path as even if i hard ... reactjsvitecreate-react-app lepaih27 1 asked feb 22, 2024 at 18:40","['reactjs', 'vite', 'create-react-app']",en,images load certain page site react project building ecommerce website problem certain page images load anymore always get alt text data issue image path even hard reactjsvitecreatereactapp repair asked feb
1056"swiftui vertically and horizontally scrolling view with fixed columns i need to make a swiftui view that can be scrolled both vertically and horizontally, with multiple columns, where the leftmost ones don't scroll horizontally, but the following ones do. think like a ... swiftui dejal 873 asked mar 18, 2022 at 4:42",['swiftui'],en,swift vertically horizontally scrolling view fixed columns need make swift view enrolled vertically horizontally multiple columns leftist ones scroll horizontally following ones think like swift deal asked mar
1057"git: warning: refname 'master' is ambiguous i saw a few people asking the same question on here but it seems none of their advice is applicable to me. i'm getting the warning that is in the title of this but i don't have any tags named ""master"".... git tim 6,711 asked oct 25, 2012 at 16:26",['git'],en,git warning refname master ambiguous saw people asking question seems none advice applicable getting warning title tags named master git tim asked oct
1058"how do i ensure that the user continues where they left off in the application in flutter? i made a book reading page with the page_flip widget, but when the user leaves the application and re-enters the book page, i want it to continue from where it left off. how can i keep the user's ... androidiosflutterdartdata-processing muhammed halil demirci 15 asked mar 8, 2024 at 5:39","['android', 'ios', 'flutter', 'dart', 'data-processing']",en,ensure user continues left application clutter made book reading page pageflip widget user leaves application reenters book page want continue left keep users androidiosflutterdartdataprocessing muhammad hall demirci asked mar
1059"problem slowing down rotation of object rotating around another object in godot 3 i have a simple scene of 2 boxes . box a is static and box b rotates around box a . simple stuff . so i get box b to rotate 180 degrees around box a , however, its rotating too fast . how does one ... rotationgodotpi chris33556 13 asked dec 31, 2023 at 18:32","['rotation', 'godot', 'pi']",en,problem slowing rotation object rotating around another object odot simple scene boxes box static box b rotates around box simple stuff get box b rotate degrees around box however rotating fast one rotationgodotpi chris asked dec
1060"prometheus does not store more than 30 days i have a prometheus server that is using 'remote_write:' in aws ams prometheus. it is currently working. however, i can only view the data for 30 days. from what i've read, they must be retained for ... amazon-web-servicesprometheusmonitoring pablo marques 81 asked jun 21, 2023 at 14:26","['amazon-web-services', 'prometheus', 'monitoring']",en,prometheus store days prometheus server using remotewrite aws ams prometheus currently working however view data days read must retained amazonwebservicesprometheusmonitoring pablo marques asked jun
1061"db2/iseries stored procedure error trapping sql state i have a stored procedure that is called from an unmonitored system and i need to trap all errors that occur. currently, i can trap any errors that occur when the data is well formed, but not when ... sqlstored-procedureserror-handlingdb2-400 kenneth mckinney 1 asked sep 27, 2023 at 16:01","['sql', 'stored-procedures', 'error-handling', 'db2-400']",en,dbseries stored procedure error trapping sql state stored procedure called monitored system need trap errors occur currently trap errors occur data well formed sqlstoredprocedureserrorhandling kenneth mckinney asked sep
1062"optimizing location-based data analysis system schema in postgresql preface: i am developing an analytics application designed for businesses operating across different geographical locations. this application allows users to analyze data based on their associated ... databasepostgresqlbackendrelational-databasesystem-design vikrant verma 159 asked may 4, 2024 at 7:38","['database', 'postgresql', 'backend', 'relational-database', 'system-design']",en,optimizing locationbased data analysis system schema postgresql preface developing analytics application designed businesses operating across different geographical locations application allows users analyze data based associated databasepostgresqlbackendrelationaldatabasesystemdesign vibrant versa asked may
1063"using brightway2 for lca of the german building sector with en 15804 conform datasets i am trying to find a way to use the brightway2 framework with ilcd+epd datasets or the en 15804 conform environmental product declarations (epds), which are also available as csv (not simapro csv), ... brightway julian_k 23 asked nov 15, 2023 at 14:58",['brightway'],en,using brightly lca german building sector en conform datasets trying find way use brightly framework icdend datasets en conform environmental product declarations ends also available csv simapro csv brightly juliank asked nov
1064"join seems to multiply rows i have two tables: table table i need to get info from table 1 and table 2 by id_banner (count of rows for equal id_banner is equal) for example, getting info for id_banner = 51 will post 3 ... sqlpostgresql andy kostryukov 33 asked apr 9, 2024 at 0:58","['sql', 'postgresql']",en,join seems multiply rows two tables table table need get info table table idbanner count rows equal idbanner equal example getting info idbanner post sqlpostgresql andy kostryukov asked apr
1065"iterableiterator in es2015 - what is it? when i implement the interface array, there are methods there return an iterableiterator. the iterableiterator extends from iterator that i can understand well and makes sense to me. interface ... typescriptecmascript-6 melatonin 81 asked dec 7, 2021 at 15:39","['typescript', 'ecmascript-6']",en,iterableiterator es implement interface array methods return iterableiterator iterableiterator extends operator understand well makes sense interface typescriptecmascript melatonin asked dec
1066"what does <value optimized out> mean in gdb? (gdb) n 134 a = b = c = 0xdeadbeef + ((uint32_t)length) + initval; (gdb) n (gdb) p a $30 = <value optimized out> (gdb) p b $31 = <value optimized out> (gdb) p c $32 = 3735928563 how can ... gdb gdb 7,819 asked mar 31, 2011 at 9:40",['gdb'],en,mean db db n b c xdeadbeef unittlength initial db n db p db p b db p c db db asked mar
1067"correct way to extend leaflet classes with typescript i am trying to extend the marker class in leaflet. i have read the tutorial on extending the class system and have managed to extend marker with my desired functionality. however, i am unable to get ... javascripttypescriptleaflet michael 421 asked jun 13, 2024 at 12:30","['javascript', 'typescript', 'leaflet']",en,correct way extend leaflet classes typescript trying extend marker class leaflet read tutorial extending class system managed extend marker desired functionality however unable get javascripttypescriptleaflet michael asked jun
1068"how do i use fonts downloaded from npm (fontsource) with tailwind css? i'm working on a next.js project, and when i download the npm package from fontsource (using the advent pro font), it downloads to my node_modules folder. in it has the font files (ttf, toff, etc.), ... npmtailwind-css sheathedblade 31 asked oct 13, 2022 at 23:54","['npm', 'tailwind-css']",en,use fonts downloaded num fontsource tailwind css working nextjs project download num package fontsource using advent pro font downloads nodemodules folder font files tt etc npmtailwindcss sheathedblade asked oct
1069"jasper report sub table i want to generate a table in my jasper report in hierarchy tree stature. but i don't get any idea how to do that. as my data is in hierarchy tree stature i can't able to populate the data in my table ... jasper-reports hasibul hoque 1 asked jan 25, 2024 at 5:39",['jasper-reports'],en,paper report sub table want generate table paper report hierarchy tree stature get idea data hierarchy tree stature cannot able populate data table paperreports hasibul poque asked jan
1070"ios 17 force screen rotation not working on ipad only i have followed all the links on google and stackoverflow, unfortunately, i could not find any reliable solution specifically for ipad devices. i am using the sample code from kodeco ... iosswiftorientationios17 krunal 482 asked nov 2, 2023 at 6:35","['ios', 'swift', 'orientation', 'ios17']",en,ios force screen rotation working ipad followed links google stackoverflow unfortunately could find reliable solution specifically ipad devices using sample code rodeo iosswiftorientationios rural asked nov
1071"how to use if else to print data to the screen in nextflow? i have a problem right there. so when i writing the nextflow workflow, i want it run automatically every step. like what happen if reads low quality, adapter ... so i think i can use the if else to ... bioinformaticsnextflow nguyễn tiến dũng 41 asked aug 2, 2023 at 3:52","['bioinformatics', 'nextflow']",en,use else print data screen nextflow problem right writing nextflow workflow want run automatically every step like happen reads low quality adapter think use else bioinformaticsnextflow guyen tien dung asked aug
1072"left outer join in rails 4 i have 3 models: class student < activerecord::base has_many :student_enrollments, dependent: :destroy has_many :courses, through: :student_enrollments end class course < activerecord::... sqlruby-on-railsruby-on-rails-4rails-activerecordmysql2 khanetor 12.3k asked jun 23, 2014 at 5:18","['sql', 'ruby-on-rails', 'ruby-on-rails-4', 'rails-activerecord', 'mysql2']",en,left outer join rails models class student activerecordbase hasmany studentenrollment dependent destroy hasmany courses studentenrollment end class course activerecord sqlrubyonrailsrubyonrailsrailsactiverecordmysql khanetor k asked jun
1073"using lombok @superbuilder using generic final child class does not compile i'm currently facing a problem with lombok's @superbuilder annotation and generics. i have an abstract parent and a final child class. when creating the child using the builder, passing values of the ... javagenericslombokbuilder melanie fuchs 65 asked jun 22, 2023 at 7:20","['java', 'generics', 'lombok', 'builder']",en,using look superbuilder using generic final child class compile currently facing problem looks superbuilder annotation generic abstract parent final child class creating child using builder passing values javagenericslombokbuilder melanie asked jun
1074"suddenly getting 400 bad request error calling openai.chat.chatclient.completechat() late last week, our azure-based rag chat service started returning http 400 bad request errors. we are running a web api on asp.net core 8. nothing in the code changed, and i have verified that our ... azureasp.net-coreopenai-apiazure-openai whosonfirst 21 asked apr 16 at 20:01","['azure', 'asp.net-core', 'openai-api', 'azure-openai']",en,suddenly getting bad request error calling openchatchatclientcompletechat late last week azurebased rag chat service started returning http bad request errors running web api aspnet core nothing code changed verified azureaspnetcoreopenaiapiazureopen whosonfirst asked apr
1075"why reading pull request data using github cli api causes ""gh: not found (http 404)"" error when run from git-bash terminal? when using the github cli api to read pull request data through git-bash terminal i get ""gh: not found (http 404)"" error. when i run the exact same script via powershell terminal or via wsl ... bashgitgithub-apigit-bash eyal gerber 1,692 asked jul 17, 2022 at 11:30","['bash', 'git', 'github-api', 'git-bash']",en,reading pull request data using github cli api causes gh found http error run gitbash terminal using github cli api read pull request data gitbash terminal get gh found http error run exact script via powershell terminal via sl bashgitgithubspiritbash etal member asked jul
1076"a way to trigger a css animation on a specific http header on an http response i need a way to efficiently trigger a css animation based on a specific http header in an http response. my backend is in rust, and i want the animation to play when triggered, rather than simply ... htmlfrontend mindeeloo 11 asked aug 11, 2024 at 6:15","['html', 'frontend']",en,way trigger css animation specific http header http response need way efficiently trigger css animation based specific http header http response backend rust want animation play triggered rather simply htmlfrontend mindeeloo asked aug
1077"cloudfront serving png/jpg vs webp based on request headers i have cloudfront in front of s3 serving images (png and jpg). i have all png and jpg images in webp format in the same directory with .webp extension. for example: png: /path/to/file.png webp: /path/... amazon-s3amazon-cloudfrontwebp afrc 914 asked sep 13, 2022 at 23:38","['amazon-s3', 'amazon-cloudfront', 'webp']",en,cloudfront serving pngjpg vs web based request headers cloudfront front serving images png jpg png jpg images web format directory web extension example png pathtofilepng web path amazonsamazoncloudfrontwebp afc asked sep
1078"how to resolve .zshenv. command not found pyenv? i have pyenv installed and my .zshenv looks like the following : export pyenv_root=""$home""/.pyenv export path=""$pyenv_root""/bin:""$path"" if command -v pyenv 1>/dev/null ... pyenv cyberpunk 1,487 asked oct 14, 2020 at 12:27",['pyenv'],en,resolve sheng command found prev prev installed sheng looks like following export prevroothomeprev export pathprevrootbinpath command v prev devnull prev cyberpunk asked oct
1079"after upgrading target sdk version to 33(android 13), flutter app is installing but not launching automatically i have changed targetsdkversion and compilesdkversion to 33,and minsdkversion is 23 in build.gradle file and in androidmanifest.xml, updated permissions like this when i do flutter run, app is ... androidandroid-api-levelsandroid-13targetsdkversionflutter-upgrade suma 53 asked may 2, 2023 at 7:24","['android', 'android-api-levels', 'android-13', 'targetsdkversion', 'flutter-upgrade']",en,upgrading target sdk version android clutter app installing launching automatically changed targetsdkversion compilesdkversion minsdkversion buildgrade file androidmanifestxml updated permissions like clutter run app androidandroidapilevelsandroidtargetsdkversionflutterupgrade sum asked may
1080"extend leaflet marker with typescript i'm working on a project with typescript and leaflet. the documented (js) way to extend the leaflet marker is like this: l.marker.foo = l.marker.extend({...}); however, typescript complains: property ... typescriptleaflet solidau 4,081 asked jan 12, 2021 at 20:56","['typescript', 'leaflet']",en,extend leaflet marker typescript working project typescript leaflet documented js way extend leaflet marker like lmarkerfoo lmarkerextend however typescript complains property typescriptleaflet solid asked jan
1081"github workflow : why my jobs are skipped when use if & contain? name: build-test on: pull_request: branches: [dev] types: [""opened"", ""synchronize""] jobs: test-front-end-customer: if: contains(github.event.pull_request.... continuous-integrationgithub-actionsworkflow nayounsang 153 asked aug 19, 2024 at 5:14","['continuous-integration', 'github-actions', 'workflow']",en,github workflow jobs skipped use contain name buildtest pullrequest branches dev types opened synchronized jobs testfrontendcustomer containsgithubeventpullrequest continuousintegrationgithubactionsworkflow nayounsang asked aug
1082"live autocomplete search code has stopped working i found and used this code on my site when i first built it years ago and it's never let me down, until now.. unfortunately i can't find the original source. up until recently, if i began typing in a ... searchgetautocompletelive davo 1 asked may 9, 2024 at 5:52","['search', 'get', 'autocomplete', 'live']",en,live autocomplete search code stopped working found used code site first built years ago never let unfortunately cannot find original source recently began typing searchgetautocompletelive dave asked may
1083"which jvm dereferenced object cleanup implementation works best? assuming an object k is associated with a scarce system resource (e.g. binded to an open port on localhost udp, of which only 65535 per machine is available). a jvm application is required to create ... javascalagarbage-collectionjava-threadsfinalizer tribbloid 3,898 asked oct 15, 2023 at 22:18","['java', 'scala', 'garbage-collection', 'java-threads', 'finalizer']",en,jv referenced object cleanup implementation works best assuming object k associated scarce system resource eg minded open port localhost per machine available jv application required create javascalagarbagecollectionjavathreadsfinalizer tribbloid asked oct
1084"spring boot azure ad token validation [duplicate] i have a java 17 spring boot 3 backend which receives an azure ad oauth2 token ( access token received from angular msalj 2.0 library @azure/msal-browser + @azure/msal-react ). in azure ad i have an ... javaspring-bootspring-securityazure-active-directory nico 1,813 asked aug 24, 2023 at 6:00","['java', 'spring-boot', 'spring-security', 'azure-active-directory']",en,spring boot azure ad token validation duplicate java spring boot backend receives azure ad oath token access token received angular small library azuremealbrowser azuremealreact azure ad javaspringbootspringsecurityazureactivedirectory nico asked aug
1085"running dbt is giving an error that the relation does not exist i'm trying to run dbt in a docker container alongside a postgresql database in another container. this is the error that i'm receiving when i run docker compose up. database error in model anime (... postgresqldockerdocker-composedbt george lam 1 asked may 26, 2024 at 21:02","['postgresql', 'docker', 'docker-compose', 'dbt']",en,running dot giving error relation exist trying run dot decker container alongside postgresql database another container error receiving run decker compose database error model anime postgresqldockerdockercomposed george lam asked may
1086"deletereport leaves devices in unresposive state for my alexa smart home skill, i sent deletereport api request & received success response from the api. then i opened alexa app on phone & now all the devices are unresponsive. when clicked ... alexa-skills-kit sujata 52 asked jan 3, 2024 at 9:29",['alexa-skills-kit'],en,deletereport leaves devices unresponsive state alexa smart home skill sent deletereport api request received success response api opened alexa app phone devices unresponsive clicked alexaskillskit strata asked jan
1087"is it possible to force a sql pulled string displayed in fpdf to have different sizing to another string in the same double quotes/cell? context this project is for an invoice application that generates a pdf from a button click. its plain and simple, approched with the mvp concept. over time, i did add a few details but they do not ... phppdfpdf-generationfpdf looped cheese 33 asked may 14, 2024 at 4:30","['php', 'pdf', 'pdf-generation', 'fpdf']",en,possible force sql pulled string displayed pdf different sizing another string double quotescell context project voice application generates pdf button click plain simple approached mvp concept time add details phppdfpdfgenerationfpdf looped cheese asked may
1088"how to create a table from remote database using dblink how to create a table from remote database using dblink create table mytable@dblink (name varchar2(20))); *cause: an attempt was made to use a ddl operation on a remote database. for example, ""... oracle-databaseoracle11gddldblink coder11 b 179 asked jun 7, 2023 at 17:09","['oracle-database', 'oracle11g', 'ddl', 'dblink']",en,create table remote database using blink create table remote database using blink create table notableblink name archer attempt made use del operation remote database example oracledatabaseoraclegddldblink coder b asked jun
1089"how to make text appear straight in a circular layout using css? i have a circular layout with 12 parts, each representing a different emotion. i'm using css to position text inside each part and i want to align the text (in each part) so it appears horizontal. ... csstextrotation tasos 1 asked mar 4, 2024 at 12:09","['css', 'text', 'rotation']",en,make text appear straight circular layout using css circular layout parts representing different emotion using css position text inside part want align text part appears horizontal csstextrotation tasks asked mar
1090"google analytics custom dimension not working: gtag set() method issues i'm trying to set up a custom dimension for ga4 called chain_id using the gtag set method. i've also added a custom_map property in the config but i'm not even sure if that is necessary. the issue is ... javascriptgoogle-analyticsgoogle-analytics-4custom-dimensions nenad vracar 122k asked sep 27, 2022 at 15:28","['javascript', 'google-analytics', 'google-analytics-4', 'custom-dimensions']",en,google analytics custom dimension working tag set method issues trying set custom dimension ga called chainid using tag set method also added custommap property config even sure necessary issue javascriptgoogleanalyticsgoogleanalyticscustomdimensions dead radar k asked sep
1091"scientific notation on the axis (literature style) - how to change default font? i need a literature-style scientific notation on both axes in matplotlib with specific font. in my search i found this question with an answer for literature-style scientific notation from ... pythonmatplotlibfontsaxis-labelsscientific-notation vrvn 3 asked feb 16, 2024 at 12:41","['python', 'matplotlib', 'fonts', 'axis-labels', 'scientific-notation']",en,scientific notation axis literature style change default font need literaturestyle scientific notation axes matplotlib specific font search found question answer literaturestyle scientific notation pythonmatplotlibfontsaxislabelsscientificnotation run asked feb
1092"zustand - infinite re-render when using many async functions with the same loading state i'm using zustand 4.1.5 in my react app. when user hits the logdetails tab, two async functions which have same loading state setting inside hit concurrently, and somehow it causes an infinite ... javascriptreactjsreact-hooksstate-managementzustand czechaj 13 asked oct 26, 2023 at 9:55","['javascript', 'reactjs', 'react-hooks', 'state-management', 'zustand']",en,husband infinite rerender using many sync functions loading state using husband react app user hits logdetails tab two sync functions loading state setting inside hit concurrently somehow causes infinite javascriptreactjsreacthooksstatemanagementzustand czech asked oct
1093"model is infeasible even though constraints are correct i have the following problem i want to solve: we have n items with a price and id, and m categories, where each category has a total balance / limit on the sum of prices of items with that category. ... pythonlinear-programmingpulp christopher bryan 13 asked feb 6, 2024 at 23:20","['python', 'linear-programming', 'pulp']",en,model feasible even though constraints correct following problem want solve n items price id categories category total balance limit sum prices items category pythonlinearprogrammingpulp christopher bryan asked feb
1094"how do i access gige camera features from twincat code? i would like to access (= read and write) gige camera features, like exposure time, etc. from twincat code (twincat vision) during runtime, instead of using the configuration assistant. i am not able ... cameratwincatgigevision rainer bärs 59 asked dec 8, 2023 at 8:40","['camera', 'twincat', 'gigevision']",en,access give camera features twincat code would like access read write give camera features like exposure time etc twincat code twincat vision runtime instead using configuration assistant able cameratwincatgigevision trainer bars asked dec
1095"react.js - wait for updated state i have a parent component (parent). this component (hook) has a state variable called refs. this variable is an object, which saves all refs used in parent component and all child components like this ... reactjsreact-hooks dns_nx 3,943 asked mar 21, 2024 at 13:19","['reactjs', 'react-hooks']",en,reactjs wait updated state parent component parent component hook state variable called refs variable object saves refs used parent component child components like reactjsreacthooks dnsnx asked mar
1096"when i signup new user i am facing this error: attributeerror: manager isn't available; 'auth.user' has been swapped for 'main.customuser' i am trying to sign up new users and add them to an existing group but i am facing this error. attributeerror: manager isn't available; 'auth.user' has been swapped for 'main.customuser' first, i ... djangodjango-modelsdjango-viewsdjango-usersdjango-custom-user rohit10 31 asked dec 16, 2023 at 18:08","['django', 'django-models', 'django-views', 'django-users', 'django-custom-user']",en,signup new user facing error attributeerror manager available authuser swapped maincustomer trying sign new users add existing group facing error attributeerror manager available authuser swapped maincustomer first djangodjangomodelsdjangoviewsdjangousersdjangocustomuser hit asked dec
1097"how can i assign default values to an array in angular when the data is loaded dynamically? i have an array called 'habits'. like this i show it in a table with radio buttons (yes, no). <tr *ngfor=""let habits of masterdate.data.habits; index as x""> <th class=""... angulartypescriptradio-buttonradio-group chathura jayawardhane 63 asked sep 18, 2023 at 20:05","['angular', 'typescript', 'radio-button', 'radio-group']",en,assign default values array angular data loaded dynamically array called habits like show table radio buttons yes th class angulartypescriptradiobuttonradiogroup chathura jayawardhane asked sep
1098"javascript: listen for postmessage events from specific iframe i have multiple iframes in a page. now i have one message event listener for the page, which gets the messages from all of the iframes. i have a workaround to know from which iframe the message is ... javascripthtmliframepostmessage forresto 12.4k asked apr 28, 2013 at 18:52","['javascript', 'html', 'iframe', 'postmessage']",en,javascript listen postmessage events specific iframe multiple frames page one message event listener page gets messages frames workaround know iframe message javascripthtmliframepostmessage forest k asked apr
1099"why does 2x2 loop unrolling run slower in python (but not when compiled with jit nopython) these functions provide identical results (assuming an even length array). the 2x2 unrolled function, however runs 30% slower when fed 10,000,000 floats. when i change the functions to run in nopython ... pythonoptimizationjitloop-unrolling bryan turns 47 asked oct 25, 2023 at 23:53","['python', 'optimization', 'jit', 'loop-unrolling']",en,x loop enrolling run slower python compiled python functions provide identical results assuming even length array x enrolled function however runs slower fed floats change functions run python pythonoptimizationjitloopenrolling bryan turns asked oct
1100"if one class contains an object of another, which coupling is it? for example, i have a class1 and then i make a class2 and use the method of the object of class1 there. if i only pass simple data, is it a 1 level coupling? i'm not really sure about it, and don't ... modulecoupling deuriul 1 asked apr 20, 2024 at 19:58","['module', 'coupling']",en,one class contains object another coupling example class make class use method object class pass simple data level coupling really sure modulecoupling deuriul asked apr
1101vlookup to find average values for duplicate ranking from ranking table i have two google sheets with following data. i want to get average of two values from lookup table if i have duplicate ranking in my target sheet. how do i achieve this using vlookup function? ... google-sheets-formulavlookup indian guy 1 asked 17 hours ago,"['google-sheets-formula', 'vlookup']",en,lookup find average values duplicate ranking ranking table two google sheets following data want get average two values lookup table duplicate ranking target sheet achieve using lookup function googlesheetsformulavlookup indian guy asked hours ago
1102"400 bad request on post request for ""https://oauth2.googleapis.com/token"" i am trying to use oauth2 but this line (responseentity tokenresponse = resttemplate.postforentity(tokenendpoint, request, map.class);) takes me to the exception of 400 bad request. i hit this ... javaspring-bootoauth-2.0google-oauthspring-security-oauth2 user30039244 1 asked 53 mins ago","['java', 'spring-boot', 'oauth-2.0', 'google-oauth', 'spring-security-oauth2']",en,bad request post request trying use oath line responseentity tokenresponse resttemplatepostforentitytokenendpoint request mapclass takes exception bad request hit javaspringbootoauthgoogleoauthspringsecurityoath user asked mins ago
1103"`java` command is not found from this python process. please ensure java is installed and path is set for `java` i don't know how to fix this error when i'm trying to run the following code: df = wrapper.read_pdf(r'c:\end_to_end\1902\pn\scenario1_allcorrectmin\epr.pdf') log: filenotfounderror ... javapythonpdfjupyter-notebook ryan ni 182 asked feb 21, 2019 at 22:26","['java', 'python', 'pdf', 'jupyter-notebook']",en,java command found python process please ensure java installed path set java know fix error trying run following code df wrapperreadpdfrcendtoendpnscenarioallcorrectminperpdf log filenotfounderror javapythonpdfjupyternotebook ryan ni asked feb
1104"spark contextcleaner not removing spilled data from usercache blockmgr folder i have a spark application where i load a dataset, join it with other dataset. and then write the result to some output. i repeat the same process multiple times with different datasets. i am not ... apache-spark best wishes 6,704 asked nov 1, 2023 at 6:39",['apache-spark'],en,spark contextcleaner removing spilled data usercache blocker folder spark application load dataset join dataset write result output repeat process multiple times different datasets apachespark best wishes asked nov
1105"how to click on the first email from gmail inbox in seleniumbase? i was trying to get id from html in order to pass it like xpath, but this id is not the same like in chrome absolute path is not suitable as it will always be different. help please :( pythonselenium-webdrivergmailseleniumbase john foux 45 asked jan 31, 2024 at 10:41","['python', 'selenium-webdriver', 'gmail', 'seleniumbase']",en,click first email gmail index seleniumbase trying get id html order pass like path id like chrome absolute path suitable always different help please pythonseleniumwebdrivergmailseleniumbase john four asked jan
1106"how to know if two strings are on the same line? i have a file that gets lines added to it each day, which contains each new day's date, and a text saying that an action has been done successfully. what i'm trying to do is to read each line and get ... perl kevsio 21 asked oct 18, 2023 at 9:34",['perl'],en,know two strings line file gets lines added day contains new days date text saying action done successfully trying read line get perl kevin asked oct
1107"how to use setprecision in julia? i am trying to increment a code that uses the setprecision function, but every time i use an example, however simple, it always gives the same error. when i do: x = big""1.23456789"" ... juliabigfloat tomaz 181 asked apr 15, 2023 at 15:53","['julia', 'bigfloat']",en,use setprecision julia trying increment code uses setprecision function every time use example however simple always gives error x big juliabigfloat tomas asked apr
1108"how to hold slope constant with geom_smooth drawing trend lines for groups? i cannot find an obvious solution in ggplot2 for a common, trivial statistics problem. i want geom_smooth(method = ""lm"") to hold the slope constant between groups in the color aesthetic. the ... rggplot2visualizationlinear-regressiongeom-point bash1000 381 asked apr 6, 2022 at 17:32","['r', 'ggplot2', 'visualization', 'linear-regression', 'geom-point']",en,hold slope constant geosmooth drawing trend lines groups cannot find obvious solution plot common trivial statistics problem want geosmoothmethod lm hold slope constant groups color aesthetic rggplotvisualizationlinearregressiongeompoint bash asked apr
1109"how does asp.net core identity ensure username is unique under concurrent conditions？ i know asp.net core identity uses uservalidator to ensure the username is unique: private async task<list<identityerror>?> validateusername(usermanager<tuser> manager, tuser user) { ... c#asp.net-coreasp.net-core-identity qslcna 129 asked mar 30, 2024 at 12:54","['c#', 'asp.net-core', 'asp.net-core-identity']",en,aspnet core identity ensure username unique concurrent conditions know aspnet core identity uses uservalidator ensure username unique private sync task validateusernameusermanager manager user user caspnetcoresnetcoreidentity qslcna asked mar
1110"how do i combine multiple gcp alerting conditions so that only one incident is created? i'm trying to create an alerting policy for a gauge type metric in google cloud platform that is expected to trigger when: the gauge's value is below 1 data is absent using terraform, i came up with ... google-cloud-platformterraformterraform-provider-gcpgcp-alerts m90 11.8k asked apr 24, 2023 at 7:02","['google-cloud-platform', 'terraform', 'terraform-provider-gcp', 'gcp-alerts']",en,combine multiple gap alerting conditions one incident created trying create alerting policy gauge type metric google cloud platform expected trigger gauges value data absent using terraform came googlecloudplatformterraformterraformprovidergcpgcpalerts k asked apr
1111"divide a dataframe into another dataframe (element by element) in pandas, i could set several named columns as an index and find the quotient of the division of two dataframe,like this import pandas as pd df_1=pd.dataframe( { 'name':['a','a','a', 'b','b', 'c'... python-polars alexandr 25 asked jan 26, 2023 at 18:56",['python-polars'],en,divide dataframe another dataframe element element panda could set several named columns index find quotient division two dataframelike import panda pd dfpddataframe nameaaa bb c pythonpolar alexander asked jan
1112"mongodb spark connector v10.x read error on databricks 13.x update the problem was solved on databricks runtime 13.3 lts. question i have facing a error when i am trying to read data from any mongodb collection using mongodb spark connector v10.x on ... pythonmongodbapache-sparkpysparkdatabricks silvadev 31 asked jul 27, 2023 at 13:08","['python', 'mongodb', 'apache-spark', 'pyspark', 'databricks']",en,mongodb spark connector vx read error databricks x update problem solved databricks runtime lt question facing error trying read data mongodb collection using mongodb spark connector vx pythonmongodbapachesparkpysparkdatabricks silvadev asked jul
1113"configure playwright to run in an asp.net core 8 web app i am trying to use playwright to run within an asp.net core 8 web app. it installed the browsers under the user profile. everything works in development. when i deploy the web app for release, it ... playwrightplaywright-dotnet mike_g 16.5k asked 18 mins ago","['playwright', 'playwright-dotnet']",en,configure playwright run aspnet core web app trying use playwright run within aspnet core web app installed browsers user profile everything works development deploy web app release playwrightplaywrightdone mikeg k asked mins ago
1114"laravel 9: notfoundhttpexception when accessing routes despite correct .htaccess and virtual host configuration i'm encountering a notfoundhttpexception error in laravel 9 despite having what seems to be the correct .htaccess configuration and virtual host setup. here are the details of my setup: .htaccess ... phplaravel.htaccesslocalhostvirtualhost zain ul abideen 33 asked feb 23, 2024 at 11:36","['php', 'laravel', '.htaccess', 'localhost', 'virtualhost']",en,travel notfoundhttpexception accessing routes despite correct access virtual host configuration encountering notfoundhttpexception error travel despite seems correct access configuration virtual host setup details setup access phplaravelhtaccesslocalhostvirtualhost main ul abide asked feb
1115the python mcp server with stdio transport throws an 'error: sse connection not established' when attempting to connect via mcp inspector i've been trying to run an example from the official repo of model context protocol for python (https://github.com/modelcontextprotocol/python-sdk). but it keeps giving me error in /message route: ... pythonmodel-context-protocol mysynaje_navucannie 1 asked apr 19 at 21:31,"['python', 'model-context-protocol']",en,python mcp server studio transport throws error sse connection established attempting connect via mcp inspector trying run example official repo model context protocol python keeps giving error message route pythonmodelcontextprotocol mysynajenavucannie asked apr
1116"nuxt 3 routing taking some time to change page on very first time i am working on nuxt 3 project with ssr: false and set the menu with the default nuxt 3 as per the folder structure standard. my issue is when we come to the website then initially if we change one ... vue.jsvuejs3nuxt.jsvue-routernuxt3.js kishan bhensadadiya 544 asked apr 17, 2023 at 5:37","['vue.js', 'vuejs3', 'nuxt.js', 'vue-router', 'nuxt3.js']",en,next routing taking time change page first time working next project ssr false set menu default next per folder structure standard issue come website initially change one vuejsvuejsnextissuerouternuxtjs khan bhensadadiya asked apr
1117"print series of prime numbers in python i was having issues in printing a series of prime numbers from one to hundred. i can't figure our what's wrong with my code. here's what i wrote; it prints all the odd numbers instead of primes: for ... pythonprimesseries user1546721 393 asked jul 23, 2012 at 20:22","['python', 'primes', 'series']",en,print series prime numbers python issues printing series prime numbers one hundred cannot figure wrong code wrote prints odd numbers instead primes pythonprimesseries user asked jul
1118"class ""powercomponents\livewirepowergrid\responsive"" not found laravel good morning, i am trying to use the responsive class in powergrid but i get the error: class ""powercomponents\livewirepowergrid\responsive"" not found. i have installed the latest version of ... laravellaravel-bladeresponsivelivewire-powergrid obernal 33 asked jul 19, 2023 at 7:34","['laravel', 'laravel-blade', 'responsive', 'livewire-powergrid']",en,class powercomponentslivewirepowergridresponsive found travel good morning trying use responsive class powergrid get error class powercomponentslivewirepowergridresponsive found installed latest version laravellaravelbladeresponsivelivewirepowergrid eternal asked jul
1119"hibernate n + 1 queries after explictly setting fetchtype.lazy being very concise: i have the following use case for my app, where i update an entity named turno (which represents a shift in a factory) package com.gco.control_de_piso.application.use_cases.turno; ... javaspring-boothibernateormbackend samuel rendón 11 asked 2 days ago","['java', 'spring-boot', 'hibernate', 'orm', 'backend']",en,liberate n queries explicitly setting fetchtypelazy concise following use case app update entity named turn represents shift factory package comgocontroldeisoapplicationusecasesturn javaspringboothibernateormbackend samuel endon asked days ago
1120"generic struct that can hold either rc<refcell<t>> or arc<rwlock<t>> i'm struggling with the implementing a struct in rust that is able to hold either rc<refcell<t>> or arc<rwlock<t>>. the motivation of such a design is to allow the user to use ... genericsrustsmart-pointersrefcell yesint 213 asked dec 2, 2023 at 13:16","['generics', 'rust', 'smart-pointers', 'refcell']",en,generic struct hold either rc arc struggling implementing struct rust able hold either rc arc motivation design allow user use genericsrustsmartpointersrefcell resist asked dec
1121"confluent kafka connection from databricks i am trying to connect to confluent-kafka from databricks and produce/consume messages. right now i am just experimenting with the python client and not the spark connectors. now, if i try to list out ... apache-kafkadatabrickskafka-pythonconfluent-kafka-python tarique 711 asked jan 10, 2024 at 7:58","['apache-kafka', 'databricks', 'kafka-python', 'confluent-kafka-python']",en,confident aka connection databricks trying connect confidentaka databricks produceconsume messages right experimenting python client spark connectors try list apachekafkadatabrickskafkapythonconfluentakapython torque asked jan
1122"click: take user options that aren't pre-defined i've got a python cli app using click. i have one command in which i defined various options. this command loads up one of several available environments. (these are reinforcement learning ... pythoncommand-line-interfaceclick ram rachum 89k asked jun 14, 2024 at 22:16","['python', 'command-line-interface', 'click']",en,click take user options predefined got python cli app using click one command defined various options command loads one several available environments reinforcement learning pythoncommandlineinterfaceclick ram racism k asked jun
1123"vaadin 14 build frontend fails due webpack error i am developing a vaadin webapp and did not change anything like maven or java version. can somebody help me here? previously it was working like a charm. when i want to build the app via maven i get ... webpackjava-11vaadin14 stimpson cat 1,528 asked nov 22, 2023 at 10:14","['webpack', 'java-11', 'vaadin14']",en,vain build frontend fails due webpage error developing vain webapp change anything like java version somebody help previously working like charm want build app via get webpackjavavain simpson cat asked nov
1124"is it possible to get rid of redundant generic parameters [duplicate] i tried to look around first, and i suppose this question is similar, but the jon skeet's answer, though accepted, is a bit too laconic for me. besides, my situation is a bit different. first, the ... c#generics roger wolf 7,732 asked 2 days ago","['c#', 'generics']",en,possible get rid redundant generic parameters duplicate tried look around first suppose question similar jon skeets answer though accepted bit iconic besides situation bit different first cgeneric roger wolf asked days ago
1125"how to fade out div when user is inactive or remove div complete to show another div this should be easy but i just can't get it to work as it should... i have a div element serving as a button. i do not want the button to be visible all the time, just to appear when the user touches ... javascriptjquery anwar ali 1 asked jan 31, 2024 at 9:38","['javascript', 'jquery']",en,fade div user inactive remove div complete show another div easy cannot get work div element serving button want button visible time appear user touches javascriptjquery near ali asked jan
1126"aws sam retrieve secret value from secret manager with dynamic referencing i have been following this official doc from aws on how to us secrets that are stored in secret manager in sam template.yaml file, and here is what i have done: environment: variables: ... amazon-web-servicesaws-lambdaaws-secrets-manager benjamin 3,826 asked jun 27, 2021 at 14:29","['amazon-web-services', 'aws-lambda', 'aws-secrets-manager']",en,aws sam retrieve secret value secret manager dynamic referencing following official doc aws us secrets stored secret manager sam templateyam file done environment variables amazonwebservicesawslambdaawssecretsmanager benjamin asked jun
1127"in my react native expo app, when i send a new message, the new message appears on top for few seconds and disappears i am working on react native (expo) private chat app, when i send a new message, the new message appears on top for few seconds and disappears. that means, the new sent message should be at the bottom ... reactjsreact-nativeexpo piyush 33 asked aug 8, 2024 at 8:34","['reactjs', 'react-native', 'expo']",en,react native expo app send new message new message appears top seconds disappears working react native expo private chat app send new message new message appears top seconds disappears means new sent message bottom reactjsreactnativeexpo push asked aug
1128"getting 'error processing request' while sending post request to website (python) i'm trying to send post request to website. website contains cloudflare but i'm using zenrows client to pypass it. i'm using vs code and python 3 - with beautifulsoup for parsing. first i'm sending ... pythonbeautifulsoup zaryab ali 161 asked sep 6, 2023 at 8:23","['python', 'beautifulsoup']",en,getting error processing request sending post request website python trying send post request website website contains cloudflare using zeros client bypass using vs code python beautifulsoup parsing first sending pythonbeautifulsoup arab ali asked sep
1129"custom navigation with navigator component in react-native i’m exploring possibilities of react native while developing a demo app with custom navigation between views with the help of navigator component. the main app class renders navigator and inside ... javascriptiosnavigationreactjsreact-native kosmetika 21.3k asked mar 29, 2015 at 22:11","['javascript', 'ios', 'navigation', 'reactjs', 'react-native']",en,custom navigation navigator component reactnative exploring possibilities react native developing demo app custom navigation views help navigator component main app class renders navigator inside javascriptiosnavigationreactjsreactnative kosmetika k asked mar
1130"delete all prior files in dist folder before 'gulp build' task begins? i'm wanting to deploy a website to a testing server. i have literally spent days watching youtubes, lynda.com/linkedin learning, etc. to find the best way to 'gulp build' a dist folder for me to ... buildgulp mmead 11 asked may 30, 2024 at 20:33","['build', 'gulp']",en,delete prior files dist folder gulf build task begins wanting deploy website testing server literally spent days watching youtube lindacomlinkedin learning etc find best way gulf build dist folder buildup mead asked may
1131"subclassing numpy array for symmetric matrices i want to create a numpy subclass specialized for symmetric matrices. i want it to be just like any numpy array with only 2 differences: it will have 2 fields for its eigendecomposition: u, d. on ... pythonnumpylinear-algebrasubclassnumpy-ndarray david 165 asked feb 3, 2024 at 10:19","['python', 'numpy', 'linear-algebra', 'subclass', 'numpy-ndarray']",en,subclassis num array symmetric matrices want create num subclass specialized symmetric matrices want like num array differences fields eigendecomposition pythonnumpylinearalgebrasubclassnumpyarray david asked feb
1132"how to make method for pandas.to_sql for making update operation? [duplicate] i got some tables in database, which must be updated. how to perform this with table.to_sql for postgresql, v.16.2? run .to_sql with if_exists='replace' will not works, cause this table related to ... pythonpandaspostgresqlsqlalchemy john doe 402 asked apr 2, 2024 at 15:39","['python', 'pandas', 'postgresql', 'sqlalchemy']",en,make method pandatosql making update operation duplicate got tables database must updated perform tabletosql postgresql v run tosql ifexistsreplace works table related pythonpandaspostgresqlsqlalchemy john doe asked apr
1133"android: where is the spinner widget's text color attribute hiding? i'm trying to change the text color of the single item that is displayed in the spinner button after you select an item from the dropdown. i've been perusing the themes.xml and styles.xml in the ... androidtextcolorsspinner christopher perry 39.3k asked may 28, 2011 at 1:26","['android', 'text', 'colors', 'spinner']",en,android spinner widgets text color attribute hiding trying change text color single item displayed spinner button select item dropdown pursuing themesxml stylesxml androidtextcolorsspinner christopher perry k asked may
1134"unable to setup azure log monitoring for aks via terraform unable to setup azure logging for aks via terraform getting this error solution name: ""logsmonitoring(*********): performing createorupdate: unexpected status 400 with error: invalidparameter: ... azureterraform gera1390 11 asked jan 10, 2024 at 9:52","['azure', 'terraform']",en,unable setup azure log monitoring via terraform unable setup azure logging via terraform getting error solution name logsmonitoring performing createorupdate unexpected status error invalidparameter azureterraform era asked jan
1135"static local variable in go is it possible to define a local variable in go that can maintain its value from one function call to another? in c, we can do this using the reserved word static. example in c: int func() { ... go gustavo bittencourt 880 asked may 31, 2015 at 13:35",['go'],en,static local variable go possible define local variable go maintain value one function call another c using reserved word static example c int func go gustavo bittencourt asked may
1136"java.lang.arrayindexoutofboundsexception: index 1 out of bounds for length 1 error is being received and cannot confirm why i understand that this error message indicates that i am trying to access a particular element in an array via index which is not present, or it is an invalid element trying to access outside of the ... javaarraysstringindexoutofboundsexception luis ramirez 9 asked feb 4, 2022 at 0:41","['java', 'arrays', 'string', 'indexoutofboundsexception']",en,javalangarrayindexoutofboundsexception index bounds length error received cannot confirm understand error message indicates trying access particular element array via index present invalid element trying access outside javaarraysstringindexoutofboundsexception luis ramirez asked feb
1137"regex named groups in java it is my understanding that the java.regex package does not have support for named groups (http://www.regular-expressions.info/named.html) so can anyone point me towards a third-party library that ... javaregex dan 5,005 asked jan 6, 2009 at 5:45","['java', 'regex']",en,regex named groups java understanding javaregex package support named groups httpwwwregularexpressionsinfonamedhtml anyone point towards thirdparty library javaregex dan asked jan
1138"how to use an anonymous function with pipe operator? i want to apply an anonymous function in a pipe chain. for example df <- tibble(vec1 = 1:10, vec = 2) the following code fails tb |> map(function(x) {x[1,1] + x[2, 1]}) how do i best use an ... rpurrr newbie 331 asked jul 31, 2019 at 15:28","['r', 'purrr']",en,use anonymous function pipe operator want apply anonymous function pipe chain example df mapfunctionx x x best use rpurrr newbie asked jul
1139"laravel php delete a directory (folder) via sftp i am trying to delete a folder on my server via sftp. i am using php 7.4.13 and laravel 7.30.4 i have set up my sftp drive and everything (upload, delete files, create directory) works fine. but the ... phplaravelfilesystemssftplaravel-filesystem eva li 31 asked jun 1, 2023 at 7:16","['php', 'laravel', 'filesystems', 'sftp', 'laravel-filesystem']",en,travel php delete directory folder via ftp trying delete folder server via ftp using php travel set ftp drive everything upload delete files create directory works fine phplaravelfilesystemssftplaravelfilesystem eva li asked jun
1140quirks of smt proof witness outputs [closed] what are the quirks of smt proof witness outputs that make it difficult to translate them into proofs for interactive proof assistants? i've read up on the smtcoq project [1] which provides an ... smt ixb 33 asked 2 days ago,['smt'],en,quirks smt proof witness outputs closed quirks smt proof witness outputs make difficult translate proofs interactive proof assistants read sitcom project provides smt ix asked days ago
1141"nginx case sensitive return i am using a subdomain to redirect to an external domain with a case sensitive url (for me, a google form). i want to go from short.mydomain.com -> externaldomain.com/reallylongandcasesensitiveurl ... nginxhttp-redirect woodsy 182 asked feb 1, 2024 at 9:29","['nginx', 'http-redirect']",en,engine case sensitive return using subdomain redirect external domain case sensitive url google form want go shortdomaincom externaldomaincomreallylongandcasesensitiveurl nginxhttpredirect woods asked feb
1142"setting excel outline options using xlsxwriter there is a table grouped using xlsxwriter, in which, due to the large number of rows, in order to collapse the group, you have to scroll the document . how can i put a collapse/expand button on the ... pythonexcelxlsxwriter михаил алёшин 23 asked oct 25, 2023 at 12:58","['python', 'excel', 'xlsxwriter']",en,setting excel outline options using xlsxwriter table grouped using xlsxwriter due large number rows order collapse group scroll document put collapseexpand button pythonexcelxlsxwriter mikhail alioshin asked oct
1143"what is this time format? how can i convert it to readable format? in my ios app, i am getting the date format as 20231220t090000 for my calendar event in response. how will i convert this datetime from the date? how to convert it to 20 dec 2023, 9 am? i can't figure ... iosswiftdatedatetimetimezone anony 15 asked jan 9, 2024 at 15:24","['ios', 'swift', 'date', 'datetime', 'timezone']",en,time format convert readable format ios app getting date format calendar event response convert daytime date convert dec cannot figure iosswiftdatedatetimetimezone anon asked jan
1144"camunda zeebe multi-region active-passive setup camunda 8 multi-region setup describes zeebe in active-active mode for overall active-passive setup. this creates some issues for our overall active-passive setup: faults in passive region are ... deploymentcloudcamundazeebe oleg efimov 672 asked apr 25, 2024 at 9:14","['deployment', 'cloud', 'camunda', 'zeebe']",en,amanda eee multiregion activepassive setup amanda multiregion setup describes eee activeactive mode overall activepassive setup creates issues overall activepassive setup faults passive region deploymentcloudcamundazeebe leg efimov asked apr
1145"google analytics (ga4) event data is different between reports and exploration i am recently new with ga4 and i found that i get different data from reports and exploration for the same event. for example i want to get the data: eventname: load result date: 2023-02-01 event ... google-analytics-4 wenjuan xie 11 asked feb 10, 2023 at 11:00",['google-analytics-4'],en,google analytics ga event data different reports exploration recently new ga found get different data reports exploration event example want get data eventpage load result date event googleanalytics wenjuan die asked feb
1146"laravel: send notifications in a batch explanation i have a notification that can have optional attachments. i would like the process to be: user modifies text of notification and optionally attaches file if file is uploaded, move it to ... phplaravelqueue rileys 91 asked oct 27, 2023 at 16:15","['php', 'laravel', 'queue']",en,travel send notifications batch explanation notification optional attachments would like process user modifies text notification optionally attaches file file uploaded move phplaravelqueue riley asked oct
1147"updating a variable in azure pipeline i have a ci/cd pipeline on azure. i have set up a .yaml file and a variable called serialnumber, set to 000000 directly in the azure interface (not in the .yaml). i want it to be used inside of the ... azureazure-devopsazure-pipelines coccosyn 21 asked apr 17, 2024 at 15:23","['azure', 'azure-devops', 'azure-pipelines']",en,updating variable azure pipeline cicd pipeline azure set yam file variable called serialnumber set directly azure interface yam want used inside azureazuredevopsazurepipelines coccosyn asked apr
1148"why jetpack compose preview and emulator show different result? preview: virtual device: code: @composable fun chatview( recentchat: recentchat, onclick: () -> unit ) { row( horizontalarrangement = arrangement.spacedby(8.dp), ... android-jetpack-compose exicode 87 asked apr 19 at 12:41",['android-jetpack-compose'],en,setback compose preview emulator show different result preview virtual device code comparable fun chatview recentchat recentchat nclick unit row horizontalarrangement arrangementspaceddp androidsetbackcompose episode asked apr
1149"azure devops: can not load nuget package from feed in azure pipeline if feed name is used i have a azure feed named samplefeed in a project sampleproject which is in organization sampleorganization. when i am restoring packages in my build pipeline i am getting error ##[error]the nuget ... azureazure-devopsyamlnugetazure-pipelines aksvinu 191 asked nov 6, 2023 at 14:20","['azure', 'azure-devops', 'yaml', 'nuget', 'azure-pipelines']",en,azure drops load nugget package feed azure pipeline feed name used azure feed named samplefeed project sampleproject organization sampleorganization restoring packages build pipeline getting error errorthe nugget azureazuredevopsyamlnugetazurepipelines aksvinu asked nov
1150"vscode call stack greyed out and full of (unknown source) i am trying to debug a segmentation fault. i am thinking i do not have vscode set up properly. here is my launch.json: { // use intellisense to learn about possible attributes. // hover to ... visual-studio-codevscode-debugger ben alan 1,703 asked jan 13, 2022 at 19:04","['visual-studio-code', 'vscode-debugger']",en,uscode call stack greed full unknown source trying debug segmentation fault thinking uscode set properly launchson use intelligence learn possible attributes hover visualstudiocodevscodedebugger ben alan asked jan
1151"c++ template method specialization by type traits i'm working in c++11, creating a class template. i wish to optimize certain methods according to the type traits of the template parameter (i.e. float/integer, signed/unsigned etc.). i know this could ... c++c++11templatesoptimizationtypes treetowngreen 15 asked sep 19, 2023 at 18:02","['c++', 'c++11', 'templates', 'optimization', 'types']",en,c template method specialization type traits working c creating class template wish optimize certain methods according type traits template parameter ie floatinteger signedunsigned etc know could cctemplatesoptimizationtypes treetowngreen asked sep
1152"how to sync sensory data and video frame received using 'ip webcam' i am working on a computer vision problem. i want to use video data along with sensory data from my mobile phone. therefore i installed an app named, ""ip webcam"". the is able to locally host ... androidcameratimestampartificial-intelligence devasya 1 asked may 23, 2024 at 4:49","['android', 'camera', 'timestamp', 'artificial-intelligence']",en,sync sensory data video frame received using ip webcam working computer vision problem want use video data along sensory data mobile phone therefore installed app named ip webcam able locally host androidcameratimestampartificialintelligence devasya asked may
1153"laravel eloquent filter by column of relationship using the eloquent orm i have my models set up like so: post belongstomany category post.php public function categories() { return $this->belongstomany('category', 'posts_categories'); } i ... phplaraveleloquenteloquent-relationship iamjonesy 25.1k asked dec 27, 2013 at 13:48","['php', 'laravel', 'eloquent', 'eloquent-relationship']",en,travel eloquent filter column relationship using eloquent models set like post belongstomany category postphp public function categories return thisbelongstomanycategory postscategories phplaraveleloquenteloquentrelationship iamjonesy k asked dec
1154"single hotkey to conditionally trigger either 'editor.action.triggerparameterhints' or 'editor.action.showhover'? i have two hotkeys: {""key"": ""ctrl+f4"", ""command"": ""editor.action.showhover""} {""key"": ""ctrl+f11"", ""command"": ""editor.action.... visual-studio-code garyatlan82 139 asked feb 8, 2024 at 19:08",['visual-studio-code'],en,single hockey conditional trigger either editoractiontriggerparameterhints editoractionshowhover two hockey key ctrlf command editoractionshowhover key ctrlf command editoraction visualstudiocode garyatlan asked feb
1155"what does it mean when addresssanitizer prints an error, but no backtrace, and program exit code is still 0? i am using asan on macos with success usually, but currently i experience the problem that my program sometimes terminates with an asan error printed, but otherwise normally. i do not get a trace like ... c++debuggingaddress-sanitizer oarfish 4,671 asked may 7, 2024 at 9:18","['c++', 'debugging', 'address-sanitizer']",en,mean addresssanitizer prints error backtrace program exit code still using san marcos success usually currently experience problem program sometimes terminates san error printed otherwise normally get trace like cdebuggingaddresssanitizer parish asked may
1156"odata in .net 6 returns byte[] properties with null value if $select is used i'm currently using .net 6 to provide a odata endpoint. when i do a get call like this https://localhost:7139/odata/documents result is good but when i use $select to have only specified properties ... .netodata.net-6.0 saeed asgari 427 asked may 11, 2023 at 10:03","['.net', 'odata', '.net-6.0']",en,data net returns byte properties null value select used currently using net provide data endpoint get call like result good use select specified properties netdatanet seed asahi asked may
1157"r package conflicts in anaconda3 i have installed anaconda 3 for mac m1 and i am trying to create a new environment for r. however, everytime i try to do this, i am faced with the below error: i am faced with this error irrespective ... ranacondaconda siddharth 1 asked oct 9, 2022 at 23:13","['r', 'anaconda', 'conda']",en,r package conflicts anaconda installed anaconda mac trying create new environment r however overtime try faced error faced error irrespective ranacondaconda siddharth asked oct
1158"how to call shopify metafields for a variant in .js? is there any way to call metafields image positions in variants? it works fine in liquid obviously, but i have one function which needs the data as well, but can only be loaded from javascript. i don'... javascriptshopifyliquid user3986510 11 asked sep 19, 2023 at 18:53","['javascript', 'shopify', 'liquid']",en,call spotify metafields variant js way call metafields image positions variants works fine liquid obviously one function needs data well loaded javascript javascriptshopifyliquid user asked sep
1159"facebook api for retrieving the business invoices i'm trying to retrieve business invoices using a curl command and testing this on facebook graph api explorer. this is the query that i'm using <fb_business_id>/business_invoices?start_date=2019-... facebook-graph-apifacebook-marketing-api mehrose 97 asked aug 18, 2022 at 16:17","['facebook-graph-api', 'facebook-marketing-api']",en,facebook api retrieving business voices trying retrieve business voices using curl command testing facebook graph api explorer query using businessvoicesstartdate facebookgraphapifacebookmarketingapi metros asked aug
1160"eclipse: no active profile set, falling back to default profiles: default in application.properties, i specified spring.profiles.active=dev which should have picked application-dev.properties as the profile to activate. however, when i run as java application in eclipse, i ... javaspringeclipsespring-bootmaven charlesw 91 asked jun 29, 2021 at 2:03","['java', 'spring', 'eclipse', 'spring-boot', 'maven']",en,eclipse active profile set falling back default profiles default applicationproperties specified springprofilesactivedev picked applicationdevproperties profile activate however run java application eclipse javaspringeclipsespringbootmaven charles asked jun
1161"search for specific content in a file present in multiple sub folders - linux i have a 'feature_config.json' file which holds flag values for multiple features, something like this: ""feature1"": { ""enabled"": true } ""feature2"": { ""... grepcommandcommand-line-interface alizaidi 27 asked jun 26, 2024 at 10:50","['grep', 'command', 'command-line-interface']",en,search specific content file present multiple sub folders linux featureconfigson file holds flag values multiple features something like feature enabled true feature grepcommandcommandlineinterface alizaidi asked jun
1162"idiomatic way for using numbers in enum items what's the best way to represent enum resolution { 2k, 4k, } ? enums don't seem to like raw identifiers as the documentation for identifiers show. + r#2k error: found invalid character; only ... rust gcb 14.6k asked dec 19, 2023 at 16:04",['rust'],en,idiomatic way using numbers num items best way represent num resolution k k genus seem like raw identifiers documentation identifiers show rk error found invalid character rust gb k asked dec
1163"assertion functions on private members is there any way to add a type predicate definition for checkevent so that i don't need the non-null-assertion operator for currentgigdata in parsedate? private parsedate(text: string) { this.... typescript jonathan tuzman 13.3k asked may 5, 2024 at 20:08",['typescript'],en,assertion functions private members way add type predicate definition checkevent need nonnullassertion operator currentgigdata passeddate private passeddatetext string typescript jonathan human k asked may
1164"getting unimplemented desc = unknown service error grpc in one of my services that happens to be my loadbalancer, i am getting the following error when calling the server method in one of my deployed services: rpc error: code = unimplemented desc = ... gogrpc matt shallow 161 asked may 11, 2018 at 9:30","['go', 'grpc']",en,getting implemented desc unknown service error grc one services happens loadbalancer getting following error calling server method one deployed services rpc error code implemented desc gogrpc matt shallow asked may
1165"bad state: mock method was not called within `when()`. was a real method called? i'm trying to make a mock of an httprequest in flutter using mockito. here i define a global http client: library utgard.globals; import 'package:http/http.dart' as http; http.client httpclient = ... dartfluttermockitoflutter-test felipe augusto 8,194 asked mar 29, 2019 at 19:47","['dart', 'flutter', 'mockito', 'flutter-test']",en,bad state mock method called within real method called trying make mock httprequest clutter using mocking define global http client library guardglobal import packagehttphttpdart http httpclient httpclient dartfluttermockitofluttertest felipe august asked mar
1166"set multiple column values for multiple rows with loc i have this dataframe: a b c d e f g h i j k 0 . . . . . . x l . . . 1 . . . . . . x a . . . . . . 300 . . . . . . x r . . . 301 . . . . . . ... pythonpandasdataframe domarius 17 asked aug 17, 2023 at 18:06","['python', 'pandas', 'dataframe']",en,set multiple column values multiple rows loc dataframe b c e f g h j k x l x x pythonpandasdataframe domains asked aug
1167"can angular app act as an authenticated user for rtdb? no code here just question. i would like to allow only authenticated users to read from rtdb, but i would not like every user to sign up. what i would prefer is to have one login that is tied to the ... angularfirebasefirebase-realtime-databasefirebase-authentication almostasnecessary 141 asked mar 20, 2024 at 19:13","['angular', 'firebase', 'firebase-realtime-database', 'firebase-authentication']",en,angular app act authenticated user rcdb code question would like allow authenticated users read rcdb would like every user sign would prefer one login tied angularfirebasefirebaserealtimedatabasefirebaseauthentication almostasnecessary asked mar
1168"implementing a trait where the order of generics matter? i have types product<a, b> and ratio<a, b> where a: baseunit, b: baseunit. i'm struggling to figure out how i can implement traits where the order of the generics matter. my first ... rust frnsys 2,454 asked aug 5, 2024 at 8:38",['rust'],en,implementing trait order generic matter types product ratio baseunit b baseunit struggling figure implement traits order generic matter first rust fdsys asked aug
1169"vba select a range of cells based on a value of another cell i want to select a range of cells in vba in which last cell selected is based on value of another cell. i want to select cells o4 to ""the cell vale of m4 (as shown in attached photo)"". i ... excelvba kaustubh agarwal 3 asked oct 2, 2023 at 10:30","['excel', 'vba']",en,via select range cells based value another cell want select range cells via last cell selected based value another cell want select cells cell vale shown attached photo excelvba kaustubh agarwal asked oct
1170"bot framework v4 : oauth implementation i am using the web chat for testing the bot skill. oauthprompt dialog does the authentication, but it requires the user to enter the authentication code in the chat window to complete the ... botframework sam 323 asked feb 18, 2024 at 2:42",['botframework'],en,bot framework v oath implementation using web chat testing bot skill oauthprompt dialog authentication requires user enter authentication code chat window complete botframework sam asked feb
1171"why are my sdl textures not being rendered onscreen? i am working with sdl3 and i am encountering an issue with rendering textures. i am able to create the textures, but they don't show up on the screen when i try to render them. here's what i'm trying ... c++sdlsdl-3 kian h 1 asked 22 hours ago","['c++', 'sdl', 'sdl-3']",en,sl textures rendered onscreen working sl encountering issue rendering textures able create textures show screen try render trying csdlsdl ian h asked hours ago
1172"hibernate cant delete one to one mapped entity in cascade i have two entities mapped one to one: entity1: @onetoone(mappedby = ""entity2"", cascade = {cascadetype.persist, cascadetype.merge, cascadetype.remove}, orphanremoval = true, fetch = ... javahibernatespring-data-jpa alexey gavrilik 13 asked feb 12, 2024 at 12:15","['java', 'hibernate', 'spring-data-jpa']",en,liberate cannot delete one one mapped entity cascade two entities mapped one one entity onetoonemapped entity cascade cascadetypepersist cascadetypemerge cascadetyperemove orphanremoval true fetch javahibernatespringdataja alexa gavrilik asked feb
1173"is there a bicep way to create a logic app api for storage using the access key? over the last few weeks i've been battling with the poor documentation for creating logic app api connection using bicep. thanks to anyone who has posted or answered similar questions on here, or ... azureazure-bicep andrew c 79 asked oct 13, 2023 at 15:27","['azure', 'azure-bicep']",en,bice way create logic app api storage using access key last weeks battling poor documentation creating logic app api connection using bice thanks anyone posted answered similar questions azureazurebice andrew c asked oct
1174"how to create an outline for an image? [closed] i'm currently using css,html, and react. i'm trying to make my ui interactable by allowing users to hover over an image, and the outline of the object will be highlighted. i searched multiple threads ... css goodsoop 1 asked 2 days ago",['css'],en,create outline image closed currently using csshtml react trying make ui intractable allowing users hover image outline object highlighted searched multiple threads css goodsoop asked days ago
1175"if condition not working correctly in oracle pl/sql my if condition is always executing else statement. i could not find reason why it's returning ""no"". it should return ""yes"". it looks like parameter xparam is getting null value ... oracle-databaseplsqlplsqldevelopersql-macro sam 1,304 asked dec 9, 2023 at 2:52","['oracle-database', 'plsql', 'plsqldeveloper', 'sql-macro']",en,condition working correctly oracle plsql condition always executing else statement could find reason returning return yes looks like parameter param getting null value oracledatabaseplsqlplsqldevelopersqlmacro sam asked dec
1176"why my calls to firebase/firestore are slower on my android flutter app the context i've developed a flutter app that runs on both android and ios devices. the app loads a list of documents from a collection stored in firestore. the problem i've observed significantly ... androidflutterfirebaseperformancegoogle-cloud-firestore nico 31 asked sep 20, 2023 at 12:39","['android', 'flutter', 'firebase', 'performance', 'google-cloud-firestore']",en,calls fishbaserestore slower android clutter app context developed clutter app runs android ios devices app loads list documents collection stored restore problem observed significantly androidflutterfirebaseperformancegooglecloudrestore nico asked sep
1177"call a plugin function from init.lua or vimrc i installed drawit plugin. in order to use it with the characters i need, i have to call a function once i've started the plugin. :distart :call setdrawit('|','-','+','\','/','+','*') what i need is ... vimpluginsneovim sébastien 55 asked oct 28, 2023 at 17:14","['vim', 'plugins', 'neovim']",en,call plugin function initlua vimeo installed draw plugin order use characters need call function started plugin distant call setdrawit need vimpluginsneovim sebastien asked oct
1178"antlr4 parser and lexer separatly im working on a simple program using antlr4, but now i'm trying to have the lexer and the parser in different files, but when i run it, i got a bunch of errors :( errors: warning(125): exprparser.g4:6:... antlr4 andré pilco chiuyare 11 asked sep 10, 2023 at 19:06",['antlr4'],en,parser lever separately working simple program using trying lever parser different files run got bunch errors errors warning exprparserg ande pico chiuyare asked sep
1179"need to convert jax-rs based legacy project to spring boot project we have a legacy project based on jax-rx (rest api) which runs on a websphere liberty. now we are in a need to migrate our on-premises applications (apis) to microsoft azure. as there is less support ... javaspring-bootjax-rswebsphere kailash 99 asked may 18, 2023 at 7:48","['java', 'spring-boot', 'jax-rs', 'websphere']",en,need convert jaxrs based legacy project spring boot project legacy project based jaxrx rest api runs websphere liberty need migrate onpremises applications apps microsoft azure less support javaspringbootjaxrswebsphere kailash asked may
1180"how to create an ""="" operator to check if a structure type is null i have never had any issues creating an operator before, but this time i am stumped. my goal is to be able to use the = operator to check if my structure type is null. example: if mystruct = nothing ... vb.netoperators john89 57 asked nov 17, 2023 at 14:40","['vb.net', 'operators']",en,create operator check structure type null never issues creating operator time stamped goal able use operator check structure type null example struct nothing vbnetoperators john asked nov
1181"how to execute javascript only on a specific view in odoo 15 without affecting other views? i am working on a custom module in odoo 15 and need to execute javascript code on a specific view (the lot verification view). however, the code is currently being executed globally across all views, ... javascriptpythonodoo roberto lópez 21 asked 2 days ago","['javascript', 'python', 'odoo']",en,execute javascript specific view odor without affecting views working custom module odor need execute javascript code specific view lot verification view however code currently executed globally across views javascriptpythonodoo roberto lopez asked days ago
1182"how do i paste data into a table using confluence 5.7? i have a pile of tabular data i need to paste onto a confluence web page. the usual mechanisms are not working properly for me. what ""usual mechanisms?"" copy the data to excel then copy / paste into ... confluence meower68 1,019 asked may 9, 2016 at 14:25",['confluence'],en,paste data table using confluence pile tabular data need paste onto confluence web page usual mechanisms working properly usual mechanisms copy data excel copy paste confluence member asked may
1183"git hub pages :failed to deploy on github pages i deployed my react app using git hub pages which is showing blank screen on inspect console it shows **failed to load resource: main.jsx ** this is github repo:repo this is the deploy linktext i have ... reactjsgitgithubgithub-pages piyush kumar 1 asked jun 20, 2024 at 20:13","['reactjs', 'git', 'github', 'github-pages']",en,git hub pages failed deploy github pages deployed react app using git hub pages showing blank screen inspect console shows failed load resource mainjs github reporepo deploy linktext reactjsgitgithubgithubpages push kumar asked jun
1184"how to pass an ""%"" wildcard to like concat operator using pgpreparedstatement i need to create a sql using pgpreparedstatement(postgres) query which has like concat operator. the query looks similar to this: select * from guest gg where gg.city like concat('phoeni_' , '%'); ... javapostgresqlprepared-statement abhinash jha 387 asked aug 5, 2024 at 7:11","['java', 'postgresql', 'prepared-statement']",en,pass wildcard like concept operator using pgpreparedstatement need create sql using pgpreparedstatementposters query like concept operator query looks similar select guest good game ggcity like conceptphoenix javapostgresqlpreparedstatement abhinash jha asked aug
1185"using sql*loader with a static column i have a table in oracle that has 6 columns and a comma-delimited text file that has 5 ""columns"" i need to put the year in the first column of each row. the year is not in the text file. it ... oracle-databasesql-loader nicole 3 asked mar 18, 2024 at 18:16","['oracle-database', 'sql-loader']",en,using sqlloader static column table oracle columns commadelimited text file columns need put year first column row year text file oracledatabasesloader nicole asked mar
1186"how can i sort a javascript array alphabetically? [duplicate] i want to sort the people alphabetically by last name. i'm curious if there's a more professional approach to doing that. my array : const people = [ 'bernhard, sandra', 'bethea, erin', 'becker, carl',... javascriptarrayssorting user22493280 asked sep 29, 2023 at 20:24","['javascript', 'arrays', 'sorting']",en,sort javascript array alphabetically duplicate want sort people alphabetically last name curious professional approach array const people bernard sandra better erin becker carl javascriptarrayssorting user asked sep
1187"use existing s3 in a cloudformation template to pass as a parameter to a ssm document i have an s3 already created ""ssm-test"". using cloudformation template i want to create a ssm document whose task is to copy a certain file from s3 to an windows instance in aws. i am not ... amazon-s3aws-cloudformationaws-ssm user1808364 1 asked apr 21, 2024 at 11:03","['amazon-s3', 'aws-cloudformation', 'aws-ssm']",en,use existing cloudformation template pass parameter ssm document already created ssmtest using cloudformation template want create ssm document whose task copy certain file windows instance aws amazonsawscloudformationawsssm user asked apr
1188"java.lang.runtimeexception:unable to instantiate org.apache.hadoop.hive.metastore.hivemetastoreclient i have configured my hive as given on link: http://www.youtube.com/watch?v=dqo1ahdbk_a, but i am getting the following error while creating a table in hive. i am using hadoop-1.2.1 and hive-0.12.0. ... hivehiveqlhive-metastore raju sharma 2,516 asked mar 28, 2014 at 11:17","['hive', 'hiveql', 'hive-metastore']",en,javalangruntimeexceptionunable instantiate orgapachehoophivemetalcorehivemetastoreclient configured hive given link httpwwwyoutubecomwatchvdoadba getting following error creating table hive using hoop hive hivehiveqlhivemetalcore raj sharma asked mar
1189"customizing ghs compiler output to display colors in visual studio code integrated terminal i'm currently using the green hills software (ghs) compiler to compile c code. i'm using visual studio code on a windows machine and using the workspace file to create my tasks. my problem is that the ... visual-studio-codegreenhills dan guilas 33 asked apr 25, 2023 at 9:41","['visual-studio-code', 'greenhills']",en,customizing gas compiler output display colors visual studio code integrated terminal currently using green hills software gas compiler compile c code using visual studio code windows machine using workspace file create tasks problem visualstudiocodegreenhills dan guilas asked apr
1190"counting deployments in datadog i have a kubernetes cluster monitored by datadog. i use the native integration and have all of the kubernetes metrics. i also have apm. while i get the time_between_deployments metric and have version ... kubernetesdeploymentdatadog alph486 1,259 asked sep 6, 2023 at 3:47","['kubernetes', 'deployment', 'datadog']",en,counting deployments catalog kubernetes cluster monitored catalog use native integration kubernetes metrics also apm get timebetweendeployments metric version kubernetesdeploymentdatadog alpha asked sep
1191"how to infer or to deduce the return type from an argument in typescript i have a type that is deductible from one field of the object. and i wrote this function that takes the zonetype and returns the associate zone. but at the end, and on each call i get : mytype1 | ... typescripttypesreturnoverloadingtype-inference erwan 23 asked may 31, 2023 at 17:09","['typescript', 'types', 'return', 'overloading', 'type-inference']",en,infer deduce return type argument typescript type deductible one field object wrote function takes monotype returns associate zone end call get type typescripttypesreturnoverloadingtypeinference erban asked may
1192"how do i use java scanner class to track arrow keys strokes why is this code not working properly? the switch case goes to default when the enter key is pressed, i.e. 'invalid key pressed', while non-arrow keys do not go to the default switch case? import java.... java victor 39 asked jan 3, 2024 at 17:56",['java'],en,use java scanner class track arrow keys strokes code working properly switch case goes default enter key pressed ie invalid key pressed nonarrow keys go default switch case import java java victor asked jan
1193"how to build qt with bazel build system? i want to make a mono repo consisting of a desktop app and an android app for desktop i am using qt and c++ to do the task but how to build the qt app with bazel i have tried to build using ... c++qtcmakebazelbazel-rules srilakshmikanthanp 2,419 asked jul 1, 2023 at 6:11","['c++', 'qt', 'cmake', 'bazel', 'bazel-rules']",en,build qt babel build system want make mono repo consisting desktop app android app desktop using qt c task build qt app babel tried build using cqtcmakebazelbazelrules srilakshmikanthanp asked jul
1194"s3 cross-region replication not working despite valid iam role and bucket policies i'm attempting to configure cross-region replication between two s3 buckets in different aws accounts and regions, but replication is not occurring. there are no relevant errors in cloudtrail or ... amazon-web-servicesamazon-s3replication jipot 106 asked 2 days ago","['amazon-web-services', 'amazon-s3', 'replication']",en,crossregion replication working despite valid iam role bucket policies attempting configure crossregion replication two buckets different aws accounts regions replication occurring relevant errors cloudtrail amazonwebservicesamazonsreplication pilot asked days ago
1195"failed to resolve entry for package ""vue-select-3"".the package may have incorrect main/module/exports specified in its package.json when i tried vite with this command (npm run prod), i got this problem. [commonjs--resolver] failed to resolve entry for package ""vue-select-3"". the package may have incorrect main/module/... npm skeet 15 asked dec 14, 2023 at 10:54",['npm'],en,failed resolve entry package vueselectthe package may incorrect mainmoduleexports specified packageson tried site command num run prod got problem commonsresolver failed resolve entry package vueselect package may incorrect mainmodule num skeet asked dec
1196"how to get last not-null value from row on google sheet dataset snapshot i would like to analyze this dataset with growth rate among years but first i need to take less recent and more recent stats achieved. every row refers to a different country and much ... sortinggoogle-sheetsrowreversing bbqberry88 1 asked oct 30, 2023 at 1:08","['sorting', 'google-sheets', 'row', 'reversing']",en,get last notnull value row google sheet dataset snapshot would like analyze dataset growth rate among years first need take less recent recent stats achieved every row refers different country much sortinggooglesheetsrowreversing bbqberry asked oct
1197"configure azure apim application with oauth 2.0 which will secure api with jwt token i have azure apim app in which i have configured 'oauth 2.0 + openid connect' > 'oauth 2.0' > add > i have added all required details. authorize and token endpoint added here are taken from ... azureoauth-2.0azure-api-managementbearer-tokenapim priyanka mane-patil 519 asked dec 21, 2023 at 15:35","['azure', 'oauth-2.0', 'azure-api-management', 'bearer-token', 'apim']",en,configure azure aim application oath secure api jet token azure aim app configured oath opened connect oath add added required details authorize token endpoint added taken azureoauthazureapimanagementbearertokenapim priyanka manepatel asked dec
1198"error: read econnreset at tcp.onstreamread (node:internal/stream_base_commons:217:20) i am trying to make a web server for the mineflayer api for my coding project. it is hosted using the free plan on render.com, and i use a cron job to keep it awake. however, when i send the bot ... javascriptnode.jsruntime-errorminecraftmineflayer the empty string photographer 157 asked apr 9, 2024 at 15:08","['javascript', 'node.js', 'runtime-error', 'minecraft', 'mineflayer']",en,error read econnreset tcponstreamread nodeinternalstreambasecommons trying make web server minelayer api coding project hosted using free plan rendercom use con job keep awake however send bot javascriptnoderuntimeerrorminecraftmineflayer empty string photographer asked apr
1199"valueerror when sorting graph nodes in networkx i want to sort graph nodes by their different attributes. i have a gdf file that has the nodes and edges of the graph and used networkx to analyze it. but i got an error on sorted fuction. here is my ... pythonsortingnetworkx zahra reyhanian 99 asked feb 5, 2024 at 20:13","['python', 'sorting', 'networkx']",en,valueerror sorting graph nodes network want sort graph nodes different attributes df file nodes edges graph used network analyze got error sorted function pythonsortingnetworkx para reyhanian asked feb
1200"typeerror: foreignkey(none) is invalid. first parameter to foreignkey must be either a model, a model name, or the string 'self' i recently developed a web app and tested its deployment on nginx and it worked just fine. the client has a preference for apache though and i created a config file. after this, i am getting a 500 ... pythondjangopostgresqlapachemod-wsgi t18nao 31 asked aug 6, 2024 at 18:21","['python', 'django', 'postgresql', 'apache', 'mod-wsgi']",en,typeerror foreignernone invalid first parameter foreigner must either model model name string self recently developed web app tested deployment engine worked fine client preference apache though created config file getting pythondjangopostgresqlapachemodwsi tnao asked aug